CK739675
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: TRX1_SCHPO (Thioredoxin-1 OS=Schizosaccharomyces pombe GN=trx1 PE=2 SV=3) HSP 1 Score: 71.2478 bits (173), Expect = 1.777e-12 Identity = 34/84 (40.48%), Postives = 52/84 (61.90%), Query Frame = 3 Query: 75 EQLQKSNETK------QLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDK 308 +Q+ S+E K +LVVVDF A+WCGPC+ IAP + + + F+KVDVD+L +A + V AMP+F K G+ +++ Sbjct: 3 KQVSDSSEFKSIVCQDKLVVVDFFATWCGPCKAIAPKFEQFSNTYSDATFIKVDVDQLSEIAAEAGVHAMPSFFLYKNGEKIEE 86
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: THIO_CHLTR (Thioredoxin OS=Chlamydia trachomatis GN=trxA PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.777e-12 Identity = 30/67 (44.78%), Postives = 45/67 (67.16%), Query Frame = 3 Query: 108 LVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDK 308 LV++DF A WCGPC+ + P L LA +LP+V LKVD+D A ++V ++PT + K+GK V++ Sbjct: 18 LVLIDFFAEWCGPCKMLTPVLEALAAELPHVTILKVDIDSSPRPAEQYSVSSIPTLILFKDGKEVER 84
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: NGLY1_CAEEL (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=F56G4.5 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.777e-12 Identity = 31/78 (39.74%), Postives = 50/78 (64.10%), Query Frame = 3 Query: 72 NEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVD 305 N L++S + +L+++DF A+WCGPCR I+P + + + N FLKV+ D + + + + AMPTF+FLK + VD Sbjct: 13 NNILERS-DANRLIIIDFFANWCGPCRMISPIFEQFSAEYGNATFLKVNCDVARDIVQRYNISAMPTFIFLKNRQQVD 89
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: TXND2_RAT (Thioredoxin domain-containing protein 2 OS=Rattus norvegicus GN=Txndc2 PE=1 SV=2) HSP 1 Score: 70.8626 bits (172), Expect = 2.320e-12 Identity = 38/95 (40.00%), Postives = 55/95 (57.89%), Query Frame = 3 Query: 3 PRKAEMAAAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLK 287 P +AE+ EEG V E + E L+ + E +LV VDF+A WCGPCR + P L+ K +V+FL+VD ++ + + D V +PTF F K Sbjct: 434 PFEAEIETLEEGMVRVIKDKEEFEEVLKDAGE--KLVAVDFSAPWCGPCRKMRPHFHSLSLKHEDVIFLEVDTEDCEQLVQDCEVFHLPTFQFYK 526
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: TXL1_SCHPO (Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe GN=txl1 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.320e-12 Identity = 36/90 (40.00%), Postives = 53/90 (58.89%), Query Frame = 3 Query: 42 VIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKL--PNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVD 305 VI + + W + KS + VD A WCGPC+ I+P ++LA K P +F KV+VDE + +A+ V+AMPTF+F + GK +D Sbjct: 3 VIEIRSYQHWISTIPKSG----YLAVDCYADWCGPCKAISPLFSQLASKYASPKFVFAKVNVDEQRQIASGLGVKAMPTFVFFENGKQID 88
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: TXND2_MOUSE (Thioredoxin domain-containing protein 2 OS=Mus musculus GN=Txndc2 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.958e-12 Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 3 Query: 12 AEMAAAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLK 287 AE+ EEG V E + E L+ + E +LV VDF+A+WCGPCR + P L+ K +V+FL+VD ++ + + D + +PTF F K Sbjct: 402 AEIETLEEGLVRVIKDKEEFEEVLKDAGE--KLVAVDFSAAWCGPCRMMKPLFHSLSLKHEDVIFLEVDTEDCEQLVQDCEIFHLPTFQFYK 491
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: THIO_EMENI (Thioredoxin OS=Emericella nidulans GN=TRX1 PE=1 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 3.958e-12 Identity = 32/73 (43.84%), Postives = 46/73 (63.01%), Query Frame = 3 Query: 84 QKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIV 302 +K K VVVD A+WCGPC+ IAP + + A+ + F ++DVDEL VA + + AMPTF+ K+G+ V Sbjct: 18 EKVLNAKGFVVVDCFATWCGPCKAIAPTVEKFAQTYTDASFYQIDVDELSEVAAELGIRAMPTFLLFKDGQKV 90
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: THIO_COPCM (Thioredoxin OS=Coprinus comatus PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.958e-12 Identity = 28/80 (35.00%), Postives = 51/80 (63.75%), Query Frame = 3 Query: 75 EQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKK--LPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDK 308 ++ K + +++++DF A+WCGPCR I+P + ++K N++F KVDVD ++ + + AMPTF K+G+ +D+ Sbjct: 9 DEFNKLTNSGKIIIIDFWATWCGPCRVISPIFEKFSEKYGANNIVFAKVDVDTASDISEEAKIRAMPTFQVYKDGQKIDE 88
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: THIO_ECHGR (Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 5.169e-12 Identity = 32/73 (43.84%), Postives = 49/73 (67.12%), Query Frame = 3 Query: 75 EQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEG 293 + L+ + + +L+V DF A+WCGPC+ +AP L +AK+ V+F+K+DVDE + VA + V AMPT + K G Sbjct: 13 DALEAAIKGDKLLVCDFFATWCGPCKSLAPKLDAMAKENEKVIFVKLDVDECQDVAEKYRVTAMPTLIVFKNG 85
BLAST of CK739675 vs. ExPASy Swiss-Prot
Match: THIO_CYAME (Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.751e-12 Identity = 35/78 (44.87%), Postives = 53/78 (67.95%), Query Frame = 3 Query: 72 NEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVD 305 NE LQ +++LV+VDF A WCGPCR I P L E+AK+ N+ ++V+ DE ++AT + + ++PT M K+G+ VD Sbjct: 11 NEVLQ----SEKLVLVDFWAPWCGPCRMIGPILEEIAKEF-NLKVVQVNTDENPNLATFYGIRSIPTLMLFKKGQRVD 83 The following BLAST results are available for this feature:
BLAST of CK739675 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 68
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK739675 ID=CK739675; Name=CK739675; organism=Citrus sinensis; type=EST; length=308bpback to top |