CK739877
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK739877 vs. ExPASy Swiss-Prot
Match: RS20_XENLA (40S ribosomal protein S20 OS=Xenopus laevis GN=rps20 PE=3 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.457e-14 Identity = 36/47 (76.60%), Postives = 43/47 (91.49%), Query Frame = 3 Query: 135 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKGLHI 275 IH+IRITL+S+NVK+LEKVC DL+RGAK+K L+VKGPVRMPTK L I Sbjct: 17 IHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63
BLAST of CK739877 vs. ExPASy Swiss-Prot
Match: RS20_SCHPO (40S ribosomal protein S20 OS=Schizosaccharomyces pombe GN=rps20 PE=1 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.442e-14 Identity = 35/53 (66.04%), Postives = 45/53 (84.91%), Query Frame = 3 Query: 117 EEAQEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKGLHI 275 ++ +H+IRITL+S+NV+NLEKVC+DLV AKDK+LRVKGPVR+PTK L I Sbjct: 11 QQIPSTVHRIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKI 63
BLAST of CK739877 vs. ExPASy Swiss-Prot
Match: RS20_DROME (40S ribosomal protein S20 OS=Drosophila melanogaster GN=RpS20 PE=1 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.120e-13 Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 3 Query: 78 MAYAAMKPTKPGLEEAQEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKGLHI 275 MA A KP + ++ +H+IRITL+S+NV++LE VC DL+ GAK++ LRVKGPVRMPTK L I Sbjct: 1 MAAAPKDIEKPHVGDSAS-VHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRI 65 The following BLAST results are available for this feature:
BLAST of CK739877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK739877 ID=CK739877; Name=CK739877; organism=Citrus sinensis; type=EST; length=275bpback to top |