CK739899
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK739899 vs. ExPASy Swiss-Prot
Match: MPPB_BLAEM (Mitochondrial-processing peptidase subunit beta OS=Blastocladiella emersonii GN=MPP1 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.386e-12 Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 3 Query: 9 QTEEVIFDHLHATAFQYTPLGRTILGPAQNIKTITKEHLQNYIHTHYTAPRMVIAASG 182 Q EEV+FDHLHA AF LG TILGP +NI+T+++ LQ YI +YTA RMV+ +G Sbjct: 166 QVEEVVFDHLHAAAFPENALGYTILGPKENIQTLSQADLQAYIKNNYTADRMVVVGAG 223
BLAST of CK739899 vs. ExPASy Swiss-Prot
Match: QCR1_RAT (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.032e-12 Identity = 28/60 (46.67%), Postives = 45/60 (75.00%), Query Frame = 3 Query: 3 EGQTEEVIFDHLHATAFQYTPLGRTILGPAQNIKTITKEHLQNYIHTHYTAPRMVIAASG 182 + + V+FD+LHATAFQ TPL + + GP++N++ +++ L +Y+ HY APRMV+AA+G Sbjct: 176 DASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLSRHYKAPRMVLAAAG 235
BLAST of CK739899 vs. ExPASy Swiss-Prot
Match: QCR1_HUMAN (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens GN=UQCRC1 PE=1 SV=3) HSP 1 Score: 70.0922 bits (170), Expect = 4.032e-12 Identity = 28/60 (46.67%), Postives = 45/60 (75.00%), Query Frame = 3 Query: 3 EGQTEEVIFDHLHATAFQYTPLGRTILGPAQNIKTITKEHLQNYIHTHYTAPRMVIAASG 182 + +V+F++LHATAFQ TPL + + GP++N++ +++ L Y+ THY APRMV+AA+G Sbjct: 176 DASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAG 235
BLAST of CK739899 vs. ExPASy Swiss-Prot
Match: MPPB_YEAST (Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae GN=MAS1 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.878e-12 Identity = 31/57 (54.39%), Postives = 43/57 (75.44%), Query Frame = 3 Query: 15 EEVIFDHLHATAFQYTPLGRTILGPAQNIKTITKEHLQNYIHTHYTAPRMVIAASGA 185 +EV+FDHLH ++ PLGRTILGP +NIK+IT+ L++YI +Y RMV+A +GA Sbjct: 159 DEVVFDHLHEITYKDQPLGRTILGPIKNIKSITRTDLKDYITKNYKGDRMVLAGAGA 215
BLAST of CK739899 vs. ExPASy Swiss-Prot
Match: QCR1_MOUSE (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.532e-11 Identity = 27/60 (45.00%), Postives = 46/60 (76.67%), Query Frame = 3 Query: 3 EGQTEEVIFDHLHATAFQYTPLGRTILGPAQNIKTITKEHLQNYIHTHYTAPRMVIAASG 182 + + V+FD+LHATAFQ TPL + + GP++N++ +++ L +Y++ +Y APRMV+AA+G Sbjct: 176 DASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRNYKAPRMVLAAAG 235
BLAST of CK739899 vs. ExPASy Swiss-Prot
Match: QCR1_EUGGR (Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial OS=Euglena gracilis PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.001e-11 Identity = 31/62 (50.00%), Postives = 45/62 (72.58%), Query Frame = 3 Query: 3 EGQTEEVIFDHLHATAFQYTPLGRTILGPAQNI-KTITKEHLQNYIHTHYTAPRMVIAASGA 185 E + +EV+ DHLH+ AF+ + LG +ILGP +NI K+ITK + +++ THYT PRM + SGA Sbjct: 155 EARIDEVLMDHLHSAAFEGSGLGLSILGPLENIQKSITKGMIDDFVKTHYTGPRMALVGSGA 216
BLAST of CK739899 vs. ExPASy Swiss-Prot
Match: QCR1_BOVIN (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 2.001e-11 Identity = 27/55 (49.09%), Postives = 44/55 (80.00%), Query Frame = 3 Query: 18 EVIFDHLHATAFQYTPLGRTILGPAQNIKTITKEHLQNYIHTHYTAPRMVIAASG 182 +V+F++LHATAFQ TPL +++ GP++N++ +++ L Y+ HY APRMV+AA+G Sbjct: 181 DVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAG 235 The following BLAST results are available for this feature:
BLAST of CK739899 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 17
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK739899 ID=CK739899; Name=CK739899; organism=Citrus sinensis; type=EST; length=227bpback to top |