CK739964
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1) HSP 1 Score: 130.954 bits (328), Expect = 1.895e-30 Identity = 59/63 (93.65%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGEV DPLYPGG Sbjct: 132 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGG 194
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB29_MAIZE (Chlorophyll a-b binding protein M9, chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1) HSP 1 Score: 130.954 bits (328), Expect = 1.895e-30 Identity = 59/63 (93.65%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGA+EGYR+AGGPLGEV DPLYPGG Sbjct: 130 WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGG 192
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1) HSP 1 Score: 130.954 bits (328), Expect = 1.895e-30 Identity = 59/63 (93.65%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGG Sbjct: 132 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGG 194
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1) HSP 1 Score: 130.954 bits (328), Expect = 1.895e-30 Identity = 59/63 (93.65%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGG Sbjct: 132 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGG 194
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1) HSP 1 Score: 130.954 bits (328), Expect = 1.895e-30 Identity = 59/63 (93.65%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGG Sbjct: 132 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGG 194
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1) HSP 1 Score: 130.954 bits (328), Expect = 1.895e-30 Identity = 59/63 (93.65%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGG Sbjct: 131 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGG 193
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1) HSP 1 Score: 130.568 bits (327), Expect = 2.475e-30 Identity = 59/63 (93.65%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGG Sbjct: 131 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGG 193
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1) HSP 1 Score: 130.568 bits (327), Expect = 2.475e-30 Identity = 58/63 (92.06%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DPLYPGG Sbjct: 130 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGG 192
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1) HSP 1 Score: 129.413 bits (324), Expect = 5.513e-30 Identity = 57/63 (90.48%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG Sbjct: 143 WFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGG 205
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1) HSP 1 Score: 129.413 bits (324), Expect = 5.513e-30 Identity = 57/63 (90.48%), Postives = 62/63 (98.41%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 WFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG Sbjct: 143 WFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGG 205 The following BLAST results are available for this feature:
BLAST of CK739964 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 65
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK739964 ID=CK739964; Name=CK739964; organism=Citrus sinensis; type=EST; length=204bpback to top |