CK739964
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2E_SOLLC (Chlorophyll a-b binding protein 3A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3A PE=3 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.323e-18 Identity = 41/43 (95.35%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 76 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGG Sbjct: 152 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGG 194
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2D_SOLLC (Chlorophyll a-b binding protein 1D (Fragment) OS=Solanum lycopersicum GN=CAB1D PE=3 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.323e-18 Identity = 41/43 (95.35%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 76 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGG Sbjct: 1 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGG 43
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2C_SOLLC (Chlorophyll a-b binding protein 1C, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1C PE=3 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.323e-18 Identity = 41/43 (95.35%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 76 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGG Sbjct: 150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGG 192
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2A_SOLLC (Chlorophyll a-b binding protein 1A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1A PE=3 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.323e-18 Identity = 41/43 (95.35%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 76 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGG 204 SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGG Sbjct: 150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGG 192
BLAST of CK739964 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 6.991e-17 Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 1 Query: 16 WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG--EVTDPLYPGG 204 WFKAGAQIF++GGL+YLGN SLIHAQSI+A A QVVLMG E YR GG G + D LYPGG Sbjct: 116 WFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGG 180 The following BLAST results are available for this feature:
BLAST of CK739964 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 65
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK739964 ID=CK739964; Name=CK739964; organism=Citrus sinensis; type=EST; length=204bpback to top |