CK740038
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK740038 vs. ExPASy Swiss-Prot
Match: COBL7_ORYSJ (COBRA-like protein 7 OS=Oryza sativa subsp. japonica GN=BC1LP1 PE=3 SV=2) HSP 1 Score: 79.337 bits (194), Expect = 6.501e-15 Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 2 Query: 2 NVQSELLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPN 142 NVQ+E++ +KD S FTF GWAFPRR+YF+G CVMPPPD YP LPN Sbjct: 366 NVQTEMILKKDKSDFTFSGGWAFPRRVYFDGHECVMPPPDQYPLLPN 412
BLAST of CK740038 vs. ExPASy Swiss-Prot
Match: COBL6_ARATH (COBRA-like protein 6 OS=Arabidopsis thaliana GN=COBL6 PE=2 SV=2) HSP 1 Score: 75.8702 bits (185), Expect = 7.188e-14 Identity = 32/49 (65.31%), Postives = 38/49 (77.55%), Query Frame = 2 Query: 2 NVQSELLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS 148 NVQ+ELL +KD FTF +GWAFPRRI FNGD CVMP PD +P LP ++ Sbjct: 378 NVQTELLLKKDMGNFTFREGWAFPRRILFNGDECVMPSPDDFPRLPKSA 426
BLAST of CK740038 vs. ExPASy Swiss-Prot
Match: COBL4_ORYSJ (COBRA-like protein 4 OS=Oryza sativa subsp. japonica GN=BC1L9 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.339e-11 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 2 Query: 2 NVQSELLFRKD---ASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYP 130 NVQ EL+ RKD +ST KG AFP R+YFNGDNCVMPPPDAYP Sbjct: 375 NVQGELIVRKDFRASSTTNNNKGRAFPVRVYFNGDNCVMPPPDAYP 420 The following BLAST results are available for this feature:
BLAST of CK740038 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK740038 ID=CK740038; Name=CK740038; organism=Citrus sinensis; type=EST; length=312bpback to top |