CK740330

Overview
NameCK740330
Unique NameCK740330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2799 contig Csv1_Contig2799:2..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_SPOFR (Eukaryotic translation initiation factor 5A OS=Spodoptera frugiperda GN=eIF-5A PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.539e-49
Identity = 90/151 (59.60%), Postives = 120/151 (79.47%), Query Frame = 1
Query:   94 EEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            E+ HFE+  D+GAS T+P Q   +RKNG++++KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVPHV R DYQL DIS+DG+++L+ +NG+ ++DL++P D  L TQL+  F  GK+L+ TV+ S GEE + A+K
Sbjct:    5 EDTHFET-GDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIP-DGDLGTQLRSDFDSGKELLCTVLKSCGEECVIAVK 153          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_SPOEX (Eukaryotic translation initiation factor 5A OS=Spodoptera exigua GN=eIF-5A PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.539e-49
Identity = 90/151 (59.60%), Postives = 120/151 (79.47%), Query Frame = 1
Query:   94 EEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            E+ HFE+  D+GAS T+P Q   +RKNG++++KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVPHV R DYQL DIS+DG+++L+ +NG+ ++DL++P D  L TQL+  F  GK+L+ TV+ S GEE + A+K
Sbjct:    5 EDTHFET-GDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIP-DGDLGTQLRSDFDSGKELLCTVLKSCGEECVIAVK 153          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_YEAST (Eukaryotic translation initiation factor 5A-1 OS=Saccharomyces cerevisiae GN=HYP1 PE=1 SV=3)

HSP 1 Score: 192.586 bits (488), Expect = 1.457e-48
Identity = 95/160 (59.38%), Postives = 127/160 (79.38%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 564
            MSDEEH FE+ ADAGAS TYP Q   +RKNG++VIKGRPCK+V++STSKTGKHGHAK H V +DIF+GKKLED+ PS+HN +VP V R++YQL+DI +DG++SL+T +G TKDD++ P  E L   ++  F EGKDL++T++S+MGEE   + K+  P+S
Sbjct:    1 MSDEEHTFEN-ADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVTLDIFTGKKLEDLSPSTHNLEVPFVKRSEYQLLDI-DDGYLSLMTMDGETKDDVKAPEGE-LGDSMQAAFDEGKDLMVTIISAMGEEAAISFKE-APRS 156          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_YEAST (Eukaryotic translation initiation factor 5A-2 OS=Saccharomyces cerevisiae GN=HYP2 PE=1 SV=3)

HSP 1 Score: 190.274 bits (482), Expect = 7.230e-48
Identity = 93/155 (60.00%), Postives = 122/155 (78.71%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKD 549
            MSDEEH FE+ ADAG+S TYP Q   +RKNG++VIK RPCK+V++STSKTGKHGHAK H V IDIF+GKKLED+ PS+HN +VP V R +YQL+DI +DGF+SL+  +G+TKDD++ P  E L   L+  F EGKDL++T++S+MGEE   + K+
Sbjct:    1 MSDEEHTFET-ADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDI-DDGFLSLMNMDGDTKDDVKAPEGE-LGDSLQTAFDEGKDLMVTIISAMGEEAAISFKE 152          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_SCHPO (Eukaryotic translation initiation factor 5A-2 OS=Schizosaccharomyces pombe GN=tif51b PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.044e-46
Identity = 88/155 (56.77%), Postives = 122/155 (78.71%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKD 549
            M++EEH      +AGAS T+P Q   +RKNG++VIKGRPCK+V++STSKTGKHGHAK H V +DIF+G+K ED+ PS+HN DVP V R +YQL++I +DG+++L+T +G TKDD+RLP  E L  ++++GF EGKDL++TV+S+MGEE   A +D
Sbjct:    1 MAEEEHVDFEGGEAGASLTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDIFNGRKYEDMSPSTHNMDVPVVKRDEYQLVNI-DDGYLNLMTTDGTTKDDVRLPEGE-LGNEIEEGFEEGKDLIITVVSAMGEEIALACRD 153          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_SCHPO (Eukaryotic translation initiation factor 5A-1 OS=Schizosaccharomyces pombe GN=tif51a PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.781e-46
Identity = 87/155 (56.13%), Postives = 122/155 (78.71%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKD 549
            M++EEH      +AGAS T+P Q   +RKNG++VIKGRPCK+V++STSKTGKHGHAK H V +DIF+G+K ED+ PS+HN DVP V R +YQL++I +DG+++L+T +G TKDD+RLP  E L  ++++GF EG+DL++TV+S+MGEE   A +D
Sbjct:    1 MAEEEHVDFEGGEAGASLTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDIFNGRKYEDMSPSTHNMDVPVVKRDEYQLVNI-DDGYLNLMTTDGTTKDDVRLPEGE-LGNEIEEGFDEGRDLIITVVSAMGEETALACRD 153          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_CANAL (Eukaryotic translation initiation factor 5A OS=Candida albicans GN=ANB1 PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.386e-45
Identity = 87/152 (57.24%), Postives = 123/152 (80.92%), Query Frame = 1
Query:   94 EEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKD 549
            EE  FE+ ADAGA+ T+P Q   +RKNG++VIK RPCK+V++STSKTGKHGHAK H V IDIF+GKKLED+ PS+HN +VP+V+R ++QL+DI +DG++SL+T +G+TKDD+++P  E L  +L+  F EGKDL++T++S+MGEE   + K+
Sbjct:    3 EEDTFET-ADAGAALTFPMQCSALRKNGHVVIKNRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPNVSRQEFQLLDI-DDGYLSLMTADGDTKDDVKVPEGE-LGDKLQSEFDEGKDLIVTIISAMGEEAAISYKE 151          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_DROME (Eukaryotic translation initiation factor 5A OS=Drosophila melanogaster GN=eIF-5A PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 2.177e-44
Identity = 87/154 (56.49%), Postives = 117/154 (75.97%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            M++ +  FE+  D+GAS TYP Q   +RKNG++++K RPCK+VE+STSKTGKHGHAK H VGIDIFS KK EDI PS+HN DVP+V R D QLI IS+D F++L+TE+G+ ++DL++P  E L  QL+  F  GKDL+ TV+ + GEE + A+K
Sbjct:    1 MAELDDQFET-TDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGE-LGEQLRLDFDSGKDLLCTVLKACGEECVIAIK 152          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_PONAB (Eukaryotic translation initiation factor 5A-2 OS=Pongo abelii GN=EIF5A2 PE=2 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 2.407e-43
Identity = 84/142 (59.15%), Postives = 110/142 (77.46%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS TYP Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R DYQLI I +DG++SLLTE G  ++DL+LP  E L  +++  +  G+D+ ++VM +M EE   A+K
Sbjct:   11 DAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGE-LGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_MOUSE (Eukaryotic translation initiation factor 5A-2 OS=Mus musculus GN=Eif5a2 PE=2 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 2.407e-43
Identity = 84/142 (59.15%), Postives = 110/142 (77.46%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS TYP Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R DYQLI I +DG++SLLTE G  ++DL+LP  E L  +++  +  G+D+ ++VM +M EE   A+K
Sbjct:   11 DAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGE-LGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK 150          
The following BLAST results are available for this feature:
BLAST of CK740330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
IF5A_SPOFR6.539e-4959.60Eukaryotic translation initiation factor 5A OS=Spo... [more]
IF5A_SPOEX6.539e-4959.60Eukaryotic translation initiation factor 5A OS=Spo... [more]
IF5A1_YEAST1.457e-4859.38Eukaryotic translation initiation factor 5A-1 OS=S... [more]
IF5A2_YEAST7.230e-4860.00Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A2_SCHPO1.044e-4656.77Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A1_SCHPO1.781e-4656.13Eukaryotic translation initiation factor 5A-1 OS=S... [more]
IF5A_CANAL4.386e-4557.24Eukaryotic translation initiation factor 5A OS=Can... [more]
IF5A_DROME2.177e-4456.49Eukaryotic translation initiation factor 5A OS=Dro... [more]
IF5A2_PONAB2.407e-4359.15Eukaryotic translation initiation factor 5A-2 OS=P... [more]
IF5A2_MOUSE2.407e-4359.15Eukaryotic translation initiation factor 5A-2 OS=M... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_6474 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740330 ID=CK740330|Name=CK740330|organism=Citrus sinensis|type=EST|length=637bp
CTCCCTCGCTCGGTCGCCCCCCAGCCTCTCTCAAAATCTCGCTCAGTAAA
TCGGCCGAGTCGGAATCAGTCAGTGCTTAAAACGATGTCGGACGAGGAGC
ATCACTTCGAGTCAAAGGCCGATGCCGGAGCCTCCAAGACTTACCCGCAG
CAAGCTGGTACCATCCGTAAGAATGGCTACATCGTCATCAAAGGCCGTCC
CTGCAAGGTTGTGGAAGTCTCCACCTCCAAGACTGGAAAGCACGGTCATG
CTAAGTGCCACTTTGTTGGAATTGATATCTTCAGTGGAAAGAAGTTGGAA
GATATTGTCCCCTCTTCTCATAACTCTGATGTTCCCCATGTCAACCGTAC
CGACTATCAGTTGATTGATATTTCTGAGGATGGATTTGTGAGTTTGCTGA
CTGAAAATGGGAACACCAAGGATGATCTGAGGCTCCCAACCGATGAGACT
CTGCTGACCCAGCTCAAGGACGGTTTTGCTGAGGGGAAGGACTTGGTTTT
GACTGTCATGTCTTCAATGGGTGAGGAGCAGATCTGTGCCCTCAAGGATA
TTGGCCCAAAGTCGTAGTTGCGCAATATGTGATTATCTGCTATGTCTGGT
TGCATCTGTTTTTTGGAAAATATTTTAATCATCTAGA
back to top