CK934143

Overview
NameCK934143
Unique NameCK934143
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12923 contig Csv1_Contig12923:1..828. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHIA_SOLCI (Acidic endochitinase pcht28 OS=Solanum chilense PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 2.509e-66
Identity = 118/218 (54.13%), Postives = 150/218 (68.81%), Query Frame = 2
Query:  185 GKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 838
            G I++RE+F+ +L +RN++ CPA+GFYTYDAFI AA +FPGFG +G++T RK+EIAAFF QT HET GG      G +  GYCF+ ++    D  D       +YYGRGPIQL+   NY R            NNPDL+ATDP++SF++AIWFWMTAQ  KPSCH VII +W PS  D  A R+PGYG+ TNIINGG+EC  G N AV +RIGF+  +
Sbjct:   28 GSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETKGG----SAGTFTGGYCFVRQI----DQSD-------RYYGRGPIQLTHQSNYERAGQGIGVGQDLVNNPDLVATDPIISFRTAIWFWMTAQDNKPSCHNVIIGQWTPSPADTAANRVPGYGVITNIINGGLECNMGPNTAVESRIGFYRRY 230          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHIA_SOLLC (Acidic 26 kDa endochitinase OS=Solanum lycopersicum GN=CHI3 PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.626e-65
Identity = 115/218 (52.75%), Postives = 145/218 (66.51%), Query Frame = 2
Query:  185 GKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 838
            G I++RE+F+ +L +RN++ CPA+GFYTYDAFI AA +FPGFG +G++T RK+EIAAFF QT HET GG      G +  GYCF+ ++               +YYGRGPIQL+   NY R            NNPDL+ATDP++SFK+AIWFWMT Q  KPSCH VII +W PS  D  A R+PGYG+ TNIING  ECG G N A  +RIGF+  +
Sbjct:   28 GSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTAGDDTARKKEIAAFFGQTSHETNGG----SAGTFTGGYCFVKQIEQSD-----------RYYGRGPIQLTHQSNYERAGQGIGVGQELVNNPDLVATDPIISFKTAIWFWMTEQDNKPSCHNVIIGQWTPSPKDTAANRVPGYGVITNIINGQFECGMGPNTAAESRIGFYRRY 230          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHI12_ORYSJ (Chitinase 12 OS=Oryza sativa subsp. japonica GN=Cht12 PE=2 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 1.626e-65
Identity = 122/226 (53.98%), Postives = 149/226 (65.93%), Query Frame = 2
Query:  182 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNET-MRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPS--DYCDPN--YPCRG--KYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 838
            +  I+SR +FD +L +RND  CPA  FYTYDAF+ AA AFPGF  +G +    KRE+AAF AQT HETTGGW  AP G YAWGYCF  E    +  DYC  +  +PC    KYYGRGPIQLS N+NY               +PDL+A+D  +SF +A WFWMT Q PKPSCH V   +W PSA+D  AGR+PGYG+ TNIINGG+ECG G +  V +RIGF+  +
Sbjct:   81 VASIVSRSLFDQMLLHRNDAACPASNFYTYDAFVAAASAFPGFAAAGGDADTNKREVAAFLAQTSHETTGGWATAPDGPYAWGYCFKEENGGAAGPDYCQQSAQWPCAAGKKYYGRGPIQLSYNFNY--GPAGQAIGADLLGDPDLVASDATVSFDTAFWFWMTPQSPKPSCHAVATGQWTPSADDQAAGRVPGYGVITNIINGGLECGHGEDDRVADRIGFYKRY 304          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHI11_ORYSJ (Chitinase 11 OS=Oryza sativa subsp. japonica GN=Cht11 PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.054e-64
Identity = 116/220 (52.73%), Postives = 154/220 (70.00%), Query Frame = 2
Query:  182 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQG-GNAAVRNRIGFFTTF 838
            +G II+R MF+ +L +R D+ C    FYTYDAFI+AA  FP FG +GN+  R+RE+AAFF QT HETTGGW  AP G +AWGYC ++E++P     DP       YYGRGPIQL+  YNY              NNPDL+++DPV++F++AIWFWMTAQ PKPSCH+VI ++W PS +D ++GRLPGYG+ TNIINGG ECG+G      ++R+G++  +
Sbjct:   27 VGSIITRAMFESMLSHRGDQGCQG-AFYTYDAFIKAAGDFPRFGTTGNDETRRRELAAFFGQTSHETTGGWATAPDGPFAWGYCRVNEITPS----DP------PYYGRGPIQLTHKYNYQLAGDALGLDLV--NNPDLVSSDPVVAFRTAIWFWMTAQSPKPSCHDVITNQWTPSGDDRSSGRLPGYGMATNIINGGEECGKGYSTDNAKDRVGYYKRY 233          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHIB_SOLLC (Acidic 27 kDa endochitinase OS=Solanum lycopersicum GN=CHI17 PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.522e-63
Identity = 119/220 (54.09%), Postives = 152/220 (69.09%), Query Frame = 2
Query:  179 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 838
            ++G I++ ++F+++L+ RND+RCPA+GFYTYDAFI AA +FPGFG +G++T RK+EIAAFF QT HETTGG   A G  +A GYCF+ E +               +YGRGPIQL+   NY              NNPDL+ATD  +SFK+AIWFWMTAQ  KPSCH+VI  +W PSA D +A R PGYG+ TNIINGGIECG+G N  V +RIGF+  +
Sbjct:   18 DVGTIVTSDLFNEMLKNRNDDRCPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETTGGSLSADG-PFAGGYCFVREGNQMGS----------GFYGRGPIQLTGQSNY--DLAGQAIGQDLVNNPDLVATDATVSFKTAIWFWMTAQGNKPSCHDVITGQWTPSAADASANRQPGYGVITNIINGGIECGKGQNPQVEDRIGFYRRY 224          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHIT_PETHY (Acidic endochitinase OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 8.352e-62
Identity = 119/216 (55.09%), Postives = 147/216 (68.06%), Query Frame = 2
Query:  182 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFF 829
            +G I++ ++FD +L+ RND RC A  FYTYDAFI AA +FPGFG +G++T RK+EIAAFF QT HETTGG   +P G YA GYCF+ E +   +           YYGRGPIQL+   NY              NNPDL+ATD  +SFK+AIWFWMT Q  KPSCH+VI   W PSA D +A R+PGYG+ TNIINGGIECG+G NA V +RIG++
Sbjct:   26 VGSIVTSDLFDQMLKNRNDARCFAVRFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETTGGTL-SPDGPYAGGYCFLREGNQMGN----------GYYGRGPIQLTGQSNY--DLAGKAIEQDLVNNPDLVATDATVSFKTAIWFWMTPQGNKPSCHDVITGRWTPSAADTSANRVPGYGVITNIINGGIECGKGQNARVEDRIGYY 228          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHIP_TOBAC (Acidic endochitinase P OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.425e-61
Identity = 118/219 (53.88%), Postives = 149/219 (68.04%), Query Frame = 2
Query:  182 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 838
            +G I++ ++F+++L+ RND RCPA GFYTYDAFI AA +FPGFG SG++T R++EIAAFF QT HETTGG   A    +  GYCF+ +    +D  D       +YYGRGPIQL+   NY +            NNPDL+ATD  +SFK+AIWFWMT Q  KPS H+VII  W PSA D +A R PG G+ TNIINGGIECG G NAAV +RIG++  +
Sbjct:   27 IGSIVTNDLFNEMLKNRNDGRCPANGFYTYDAFIAAANSFPGFGTSGDDTARRKEIAAFFGQTSHETTGGSLSAE--PFTGGYCFVRQ----NDQSD-------RYYGRGPIQLTNQNNYEKAGNAIRQDLV--NNPDLVATDATISFKTAIWFWMTPQDNKPSSHDVIIGSWTPSAADQSANRAPGCGVITNIINGGIECGVGPNAAVEDRIGYYRRY 230          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHIQ_TOBAC (Acidic endochitinase Q OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.174e-61
Identity = 117/219 (53.42%), Postives = 149/219 (68.04%), Query Frame = 2
Query:  182 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 838
            +G I++ ++F+++L+ RND RCPA GFYTYDAFI AA +FPGFG +G++T R++EIAAFF QT HETTGG   A    +  GYCF+ +    +D  D       +YYGRGPIQL+   NY +            NNPDL+ATD  +SFK+AIWFWMT Q  KPS H+VII  W PSA D  A R+PGYG+ TNIINGGIECG G N AV +RIG++  +
Sbjct:   27 IGSIVTSDLFNEMLKNRNDGRCPANGFYTYDAFIAAANSFPGFGTTGDDTARRKEIAAFFGQTSHETTGGSLSAE--PFTGGYCFVRQ----NDQSD-------RYYGRGPIQLTNRNNYEKAGTAIGQELV--NNPDLVATDATISFKTAIWFWMTPQDNKPSSHDVIIGRWTPSAADQAANRVPGYGVITNIINGGIECGIGRNDAVEDRIGYYRRY 230          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHIB_POPTR (Acidic endochitinase WIN6.2B OS=Populus trichocarpa PE=2 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 7.071e-61
Identity = 116/220 (52.73%), Postives = 137/220 (62.27%), Query Frame = 2
Query:  182 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPNYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGG-NAAVRNRIGFFTTF 838
            L  II   MFDD+L+YRND +CPA GFYTY+AFI AA+ FP FGN+G++ MRKREIAAF  QT HET G WP A G +Y WGYC +                              NYNY  C             P+L+ TDP ++FK+A+WFWMT Q PKPSCH VI + W PSA D  AGR+PGYG+ TNIINGGIECGQGG N A  NRIGF+ T+
Sbjct:   85 LSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETNGWWPAAQGDQYDWGYCHM------------------------------NYNYGLCGDDLNLPLL--QEPELVETDPFIAFKTALWFWMTPQSPKPSCHAVITESWTPSAADSEAGRVPGYGVITNIINGGIECGQGGPNNANENRIGFYKTY 272          
BLAST of CK934143 vs. ExPASy Swiss-Prot
Match: CHI8_POPTR (Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.129e-58
Identity = 105/219 (47.95%), Postives = 140/219 (63.93%), Query Frame = 2
Query:  197 SREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDP----NYPCRGKYYGRGPIQLSRNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPP-KPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 838
            +  MF+ +L  RN++ CP +GFYTYDA+  A + +PGFG +G++  RKRE+AAFFAQT  ET+G         + WGYC ++E++P SDYCDP    +YPC   YYGRGP+QL  NYNY  C           + P+ +ATDPVLSF++A+WFWM       PSCHEVI  EW PS  D+ AGR PG+G+ TNII  G EC + G    +NRI ++  +
Sbjct:   68 TESMFEQMLPNRNNDSCPGKGFYTYDAYFVATEFYPGFGMTGDDDTRKRELAAFFAQTSQETSGRSIIGEDAPFTWGYCLVNELNPNSDYCDPKTKSSYPCVADYYGRGPLQLRWNYNYGEC--GNYLGQNLLDEPEKVATDPVLSFEAALWFWMNPHSTGAPSCHEVITGEWSPSEADIEAGRKPGFGMLTNIITNGGECTKDGKTRQQNRIDYYLRY 284          
The following BLAST results are available for this feature:
BLAST of CK934143 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHIA_SOLCI2.509e-6654.13Acidic endochitinase pcht28 OS=Solanum chilense PE... [more]
CHIA_SOLLC1.626e-6552.75Acidic 26 kDa endochitinase OS=Solanum lycopersicu... [more]
CHI12_ORYSJ1.626e-6553.98Chitinase 12 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHI11_ORYSJ1.054e-6452.73Chitinase 11 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHIB_SOLLC1.522e-6354.09Acidic 27 kDa endochitinase OS=Solanum lycopersicu... [more]
CHIT_PETHY8.352e-6255.09Acidic endochitinase OS=Petunia hybrida PE=2 SV=1[more]
CHIP_TOBAC1.425e-6153.88Acidic endochitinase P OS=Nicotiana tabacum PE=1 S... [more]
CHIQ_TOBAC3.174e-6153.42Acidic endochitinase Q OS=Nicotiana tabacum PE=1 S... [more]
CHIB_POPTR7.071e-6152.73Acidic endochitinase WIN6.2B OS=Populus trichocarp... [more]
CHI8_POPTR1.129e-5847.95Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004540_H05 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IF_H05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934143 ID=CK934143; Name=CK934143; organism=Citrus sinensis; type=EST; length=838bp
GGGGATCACCAAGCAGAGGATAATTGATATCATAACTGTNNNTTTCAAAA
TGAGGCTTATTGGGTCCTTACTAATTTTCTCTCTAGTTTTATCTTTTGTA
CTAGGAGGCTCAGCACAGAACTGTGGAAGCGGCGTTGTGTACGGTGGACG
TGATACCGGCCATGGGACGCATGGCGGTGAACTGGGCAAGATCATCTCAA
GGGAGATGTTTGATGACTTGCTTGAGTATAGAAATGATGAACGATGCCCT
GCCAGAGGCTTCTACACTTATGATGCTTTTATAGAGGCAGCCCAAGCTTT
TCCAGGCTTTGGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATCG
CTGCCTTTTTTGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGAT
GCACCTGGTGGCGAATATGCTTGGGGATATTGCTTTATAAGCGAAGTTAG
CCCTCCGTCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACT
ATGGCCGAGGTCCAATTCAACTCTCTCGGAATTACAATTACTTACGGTGC
GGAGAAGGCCTAGGGCTAGGAGAGGAGTTGTTGAACAATCCAGACCTTCT
TGCTACTGATCCAGTACTATCATTCAAGTCAGCAATCTGGTTCTGGATGA
CTGCACAGCCACCAAAGCCATCGTGCCACGAAGTCATTATCGACGAATGG
AAACCATCAGCAAATGACGTAAACGCCGGCCGGCTTCCGGGATACGGTCT
AACCACAAATATAATCAACGGTGGAATTGAATGTGGCCAAGGTGGGAATG
CCGCTGTACGTAACCGTATTGGGTTCTTTACCACTTTC
back to top