CK934167

Overview
NameCK934167
Unique NameCK934167
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length630
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6163 contig Csv1_Contig6163:7..637. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_ASEAQ (Histone H4 OS=Asellus aquaticus GN=His4 PE=3 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 5.267e-35
Identity = 74/76 (97.37%), Postives = 76/76 (100.00%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_ACRAS (Histone H4 OS=Acrolepiopsis assectella GN=His4 PE=3 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 5.267e-35
Identity = 74/76 (97.37%), Postives = 76/76 (100.00%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_DENKL (Histone H4 OS=Dendronephthya klunzingeri GN=H4DEKL PE=3 SV=3)

HSP 1 Score: 147.132 bits (370), Expect = 6.879e-35
Identity = 73/76 (96.05%), Postives = 76/76 (100.00%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRT
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_ACRFO (Histone H4 OS=Acropora formosa PE=3 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 6.879e-35
Identity = 73/76 (96.05%), Postives = 76/76 (100.00%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRT
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H43_MAIZE (Histone H4.3 OS=Zea mays GN=H4 PE=1 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 8.984e-35
Identity = 75/76 (98.68%), Postives = 75/76 (98.68%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV KIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVRKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_STYPL (Histone H4 OS=Styela plicata PE=3 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 1.173e-34
Identity = 73/76 (96.05%), Postives = 76/76 (100.00%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTA+DVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTALDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_PYRSA (Histone H4 OS=Pyrenomonas salina PE=3 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 1.173e-34
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK+FLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRSVLKVFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_OIKDI (Histone H4 OS=Oikopleura dioica GN=H4.1 PE=3 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 1.173e-34
Identity = 73/76 (96.05%), Postives = 76/76 (100.00%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTA+DVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTALDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_STRPU (Histone H4 OS=Strongylocentrotus purpuratus PE=3 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 2.614e-34
Identity = 73/76 (96.05%), Postives = 75/76 (98.68%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKTVTAMDVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRT 97          
BLAST of CK934167 vs. ExPASy Swiss-Prot
Match: H4_PYCHE (Histone H4 OS=Pycnopodia helianthoides PE=3 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 2.614e-34
Identity = 73/76 (96.05%), Postives = 75/76 (98.68%), Query Frame = 1
Query:  169 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 396
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKTVTAMDVVYALKRQGRT
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRT 97          
The following BLAST results are available for this feature:
BLAST of CK934167 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
H4_ASEAQ5.267e-3597.37Histone H4 OS=Asellus aquaticus GN=His4 PE=3 SV=2[more]
H4_ACRAS5.267e-3597.37Histone H4 OS=Acrolepiopsis assectella GN=His4 PE=... [more]
H4_DENKL6.879e-3596.05Histone H4 OS=Dendronephthya klunzingeri GN=H4DEKL... [more]
H4_ACRFO6.879e-3596.05Histone H4 OS=Acropora formosa PE=3 SV=2[more]
H43_MAIZE8.984e-3598.68Histone H4.3 OS=Zea mays GN=H4 PE=1 SV=3[more]
H4_STYPL1.173e-3496.05Histone H4 OS=Styela plicata PE=3 SV=3[more]
H4_PYRSA1.173e-3497.37Histone H4 OS=Pyrenomonas salina PE=3 SV=3[more]
H4_OIKDI1.173e-3496.05Histone H4 OS=Oikopleura dioica GN=H4.1 PE=3 SV=3[more]
H4_STRPU2.614e-3496.05Histone H4 OS=Strongylocentrotus purpuratus PE=3 S... [more]
H4_PYCHE2.614e-3496.05Histone H4 OS=Pycnopodia helianthoides PE=3 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004540_F04 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IF_F04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934167 ID=CK934167; Name=CK934167; organism=Citrus sinensis; type=EST; length=630bp
GGGGACTACAAAAAAAACGAGCAAAGGTTGAGAGTGGGGGAAAAAAGAAA
GAAAAATTCCCAATTAGTTTGAAAACCGTAATTAGCATTTTAATTTCGTA
GCAGAATGTCTGGACGCGGCAAGGGAGGCAAGGGATTGGGGAAGGGAGGA
GCCAAGAGGCATCGCAAGGTGTTGCGTGATAACATTCAGGGCATCACCAA
GCCGGCTATTCGCCGTTTGGCCAGAAGAGGAGGCGTTAAGAGAATCAGCG
GTCTCATCTACGAGGAGACACGCGGCGTCCTCAAGATCTTTTTGGAGAAC
GTCATTCGCGATGCTGTGACCTACACTGAGCACGCTCGCCGAAAGACGGT
GACCGCCATGGATGTCGTTTATGCGCTCAAGAGGCAGGGCAGGACTCTCT
ATGGGTTTGGTGGTTGATGTGGCGTCGTTTTGTATTTTGTGTTTTAGGGT
TTTCCTTTTTTCCTGTAAATCAGTGAACGTGGTTGTGTCTAGCGAGTGGG
TTTAAATTGGAGGCAACTTGTATTTGCCGTTTCCTAGGGGTTTTTATTTT
TTTGGTTCATTGGTGTTTTCATCTTTTGCAATGAGAATCTAGTTGTTTGC
CAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top