CK934442
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBD6_MOUSE (Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 4.866e-11 Identity = 33/85 (38.82%), Postives = 47/85 (55.29%), Query Frame = 2 Query: 35 KGEMGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 289 +G L E FE+ A + L + + E L LY +KQ VG NT +P F+ + KW+AWKA+ S +AM +YI VK+L Sbjct: 37 EGTRSLAELFEKAAAHVQGLVQVASREQLLYLYARFKQVKVGNCNTPKPNFFDFEGKQKWEAWKALGDSSPSQAMQEYIAAVKKL 121
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBD5_PONAB (Acyl-CoA-binding domain-containing protein 5 OS=Pongo abelii GN=ACBD5 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 4.866e-11 Identity = 34/85 (40.00%), Postives = 51/85 (60.00%), Query Frame = 2 Query: 53 QEEFEEHAEKAKTLPES----TTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQE 295 + FE + ++LP++ TNE L Y YKQAT GP +RPG ++ R KWDAW ++ +KEEAMS Y+ ++K++ E Sbjct: 44 ETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMSAYVEEMKKIIE 128 The following BLAST results are available for this feature:
BLAST of CK934442 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK934442 ID=CK934442; Name=CK934442; organism=Citrus sinensis; type=EST; length=533bpback to top |