CK934669
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK934669 vs. ExPASy Swiss-Prot
Match: TR548_MIMIV (Thioredoxin-like protein R548 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R548 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.580e-11 Identity = 31/89 (34.83%), Postives = 54/89 (60.67%), Query Frame = 1 Query: 169 NETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPYVLFLKVDV--DELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAK 429 +E+K LV++DF +WCGPC+ IAP +A+K P V F K++ + L ++ + ++PTF F K GK + + V + L+++I + Sbjct: 46 DESKGLVIIDFFTTWCGPCKRIAPDYIRMAEKYPTVSFYKINAENENLANIVAACEIVSLPTFCFFKAGKYIGRFVNADPVGLEKSIVE 134
BLAST of CK934669 vs. ExPASy Swiss-Prot
Match: THIO_PORYE (Thioredoxin OS=Porphyra yezoensis GN=trxA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.813e-11 Identity = 30/86 (34.88%), Postives = 56/86 (65.12%), Query Frame = 1 Query: 187 VVVDFTASWCGPCRFIAPFLAELAKKL-PYVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGS-KKEELQQTIAKHLA 438 V+VDF A WCGPCR ++P + E+A++ + +K++ D+ ++A ++ + ++PT M K G+ VD V+G+ K L T+ K+++ Sbjct: 22 VLVDFWAPWCGPCRMVSPVVDEIAEEYESSIKVVKINTDDNPTIAAEYGIRSIPTLMIFKAGERVDTVIGAVPKSTLASTLNKYIS 107
BLAST of CK934669 vs. ExPASy Swiss-Prot
Match: THIO_CHLLT (Thioredoxin OS=Chlorobium limicola f.sp. thiosulfatophilum GN=trxA PE=1 SV=5) HSP 1 Score: 67.3958 bits (163), Expect = 7.813e-11 Identity = 31/90 (34.44%), Postives = 57/90 (63.33%), Query Frame = 1 Query: 172 ETKQLVVVDFTASWCGPCRFIAPFLAELAKKLP-YVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGS-KKEELQQTIAKHL 435 ++ + V+VDF ASWCGPC + P + +LA + K++VDE ++A + + ++PT + +K GK+VD++VG+ K + + I +H+ Sbjct: 18 DSDKAVLVDFWASWCGPCMMLGPVIEQLADDYEGKAIIAKLNVDENPNIAGQYGIRSIPTMLIIKGGKVVDQMVGALPKNMIAKKIDEHI 107
BLAST of CK934669 vs. ExPASy Swiss-Prot
Match: GLRX3_HUMAN (Glutaredoxin-3 OS=Homo sapiens GN=GLRX3 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 7.813e-11 Identity = 30/92 (32.61%), Postives = 56/92 (60.87%), Query Frame = 1 Query: 172 ETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPYVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATAS 447 + K L+VV F A W C + +AELAK+LP V F+K++ + + V+ + + ++PTF+F K + +D++ G+ EL + + +H ++ S Sbjct: 29 KAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGS 120 The following BLAST results are available for this feature:
BLAST of CK934669 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 104
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK934669 ID=CK934669; Name=CK934669; organism=Citrus sinensis; type=EST; length=672bpback to top |