CK935508

Overview
NameCK935508
Unique NameCK935508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PICTO (30S ribosomal protein S12P OS=Picrophilus torridus GN=rps12p PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.213e-38
Identity = 76/136 (55.88%), Postives = 103/136 (75.74%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            G+ AG+KL   R+  RW+D+ YK+  L  + K  P  G+  AKGIV+EK+GIEAKQPNS IRKC ++QLIKNG++++AF P DG +NYI+E+DEV++ G  GR G + GDIPGVR+KV+KV+G+SL  L K +KEK
Sbjct:    4 GLNAGKKLMKSRKTYRWSDRDYKRRVLNLKKKSDPLEGAPQAKGIVIEKVGIEAKQPNSGIRKCVKIQLIKNGRQLSAFAPGDGAINYIDEHDEVVVEGIGGRMGRSKGDIPGVRYKVIKVNGISLHELVKGRKEK 139          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRIL (30S ribosomal protein S12P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=rps12p PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.098e-37
Identity = 79/137 (57.66%), Postives = 105/137 (76.64%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ AG KLK  R+R +W D +YK+  LG   K  P  G+  A+GIVLEK+G+EA++PN+A+RKC RVQL+KNGK + AFVP DG LNYI E+DEV+I    G +G ++GDIPGVRFKV+KV+GVSL A+++ KK+KP
Sbjct:    9 GLFAGGKLKRKRKRFKWNDITYKRKMLGLVEKYDPLEGAPMARGIVLEKVGVEARKPNAAVRKCVRVQLVKNGKVVTAFVPLDGSLNYINEHDEVIIERIGGPEGRSLGDIPGVRFKVIKVNGVSLWAIWRGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRCJ (30S ribosomal protein S12P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps12p PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.098e-37
Identity = 80/137 (58.39%), Postives = 105/137 (76.64%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ AG KLK  R++ RW D +YK+  LG   K  P  G+  A+GIVLEK+G+EA++PN+A+RKC RVQL+KNGK + AFVP DG LNYI E+DEV+I    G +G ++GDIPGVRFKVVKV+GVSL A+++ KK+KP
Sbjct:    9 GLFAGGKLKKKRQKFRWNDVTYKRRMLGLAEKYDPLEGAPMARGIVLEKVGVEARKPNAAVRKCVRVQLVKNGKVVTAFVPYDGGLNYINEHDEVIIERIGGPEGKSLGDIPGVRFKVVKVNGVSLWAIWRGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRAE (30S ribosomal protein S12P OS=Pyrobaculum aerophilum GN=rps12p PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.434e-37
Identity = 79/137 (57.66%), Postives = 105/137 (76.64%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ AG KLK  R++ RW D +YK+  LG   K  P  G+  A+GIVLEK+G+EA++PN+A+RKC RVQL+KNGK + AFVP DG LNYI E+DEV+I    G +G ++GDIPGVRFKV+KV+GVSL A+++ KK+KP
Sbjct:    9 GLFAGGKLKRKRQKFRWNDVTYKRKMLGLVEKYDPLEGAPMARGIVLEKVGVEARKPNAAVRKCVRVQLVKNGKVVTAFVPLDGSLNYINEHDEVVIERIGGPEGRSLGDIPGVRFKVIKVNGVSLWAIWRGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRAR (30S ribosomal protein S12P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps12p PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.873e-37
Identity = 79/137 (57.66%), Postives = 104/137 (75.91%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ AG KLK  R+R +W D +YK+  LG   K  P  G+  A+GIVLEK+G+EA++PN+A+RKC RVQL+KNGK + AFVP DG LNYI E+DEV+I    G +G ++GDIPGVRFKV+KV+GVSL A++  KK+KP
Sbjct:    9 GLFAGGKLKRKRKRFKWNDVTYKRKMLGLVEKYDPLEGAPMARGIVLEKVGVEARKPNAAVRKCVRVQLVKNGKVVTAFVPLDGSLNYINEHDEVVIERIGGPEGRSLGDIPGVRFKVIKVNGVSLWAIWSGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METKA (30S ribosomal protein S12P OS=Methanopyrus kandleri GN=rps12p PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.873e-37
Identity = 81/137 (59.12%), Postives = 101/137 (73.72%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G  A RKL+  R++ RW D+ YK+  L  +E   P  G+  A+GIVLEK+G+EAKQPNSAIRKC RVQLIKNGK++ AF P DG ++YI+E+DEV+I G  G KG A GDIPGVR+KVVKV+ V+L  L K K EKP
Sbjct:    9 GEFAARKLREKRKKFRWKDERYKRRMLKLDEKADPLEGAPQARGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAIDYIDEHDEVVIEGIGGPKGRAKGDIPGVRYKVVKVNDVALSELLKGKIEKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_THEVO (30S ribosomal protein S12P OS=Thermoplasma volcanium GN=rps12p PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.195e-37
Identity = 78/136 (57.35%), Postives = 101/136 (74.26%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            G+ AGRKL  +R++ RW+D+ YK+  L  + K  P  G+  AKGI +EK+GIEAKQPNSAIRKC +VQLIKNG++I AF   DG +NYI+E+DEV + G  GR G + GDIPGVR+KVV V+G+SL  L K +KEK
Sbjct:    4 GLNAGRKLLENRKKFRWSDRDYKRRVLQLKRKSDPLEGAPQAKGIAIEKVGIEAKQPNSAIRKCVKVQLIKNGRQITAFAVGDGAINYIDEHDEVTVEGIGGRMGRSKGDIPGVRYKVVAVNGISLKELVKGRKEK 139          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_THECE (30S ribosomal protein S12P OS=Thermococcus celer GN=rps12p PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.195e-37
Identity = 83/145 (57.24%), Postives = 103/145 (71.03%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            A  +   G  AGRKLK  R++ RW+D  YK+  L   E   P  G+  AKGIVLEKI +EAKQPNSA+RK  RVQLIKNGK + AF P DG +N+I+E+DEV+I G  G KG ++GDIPG+R+KVVKV+ VSL  L K +KEKPR
Sbjct:    2 AGKKAPYGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQAKGIVLEKIAVEAKQPNSAMRKAVRVQLIKNGKVVTAFTPGDGAINHIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_THEAC (30S ribosomal protein S12P OS=Thermoplasma acidophilum GN=rps12p PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.173e-37
Identity = 78/136 (57.35%), Postives = 101/136 (74.26%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            G+ AGRKL  +R++ RW+D+ YK+  L  + K  P  G+  AKGI +EK+GIEAKQPNSAIRKC +VQLIKNG++I AF   DG +NYI+E+DEV + G  GR G + GDIPGVR+KVV V+G+SL  L K +KEK
Sbjct:    4 GINAGRKLLENRKKFRWSDRDYKRRVLQLKRKSDPLEGAPQAKGIAIEKVGIEAKQPNSAIRKCVKVQLIKNGRQITAFAVGDGAINYIDEHDEVTVEGIGGRMGRSKGDIPGVRYKVVAVNGISLKELVKGRKEK 139          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_ENCCU (40S ribosomal protein S23 OS=Encephalitozoon cuniculi GN=RPS23 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.450e-37
Identity = 80/136 (58.82%), Postives = 96/136 (70.59%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSS-HAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ +   L   R+ +R AD +Y+K  LG ++K    G +  AK IVLEKIG+EAKQPNSAIRK  R QLI  GKKI AFVP DG + YIE NDEV + GFG+KG +VGDIPG+RFKV KV  VSL A+F  KKEKP
Sbjct:    3 GLFSANNLIKSRKAKRLADTAYRKRALGTKYKHSVLGRAPQAKAIVLEKIGVEAKQPNSAIRKAVRCQLIATGKKITAFVPYDGSVTYIESNDEVTVEGFGKKGRSVGDIPGIRFKVCKVQNVSLHAIFTGKKEKP 138          
The following BLAST results are available for this feature:
BLAST of CK935508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS12_PICTO2.213e-3855.8830S ribosomal protein S12P OS=Picrophilus torridus... [more]
RS12_PYRIL1.098e-3757.6630S ribosomal protein S12P OS=Pyrobaculum islandic... [more]
RS12_PYRCJ1.098e-3758.3930S ribosomal protein S12P OS=Pyrobaculum calidifo... [more]
RS12_PYRAE1.434e-3757.6630S ribosomal protein S12P OS=Pyrobaculum aerophil... [more]
RS12_PYRAR1.873e-3757.6630S ribosomal protein S12P OS=Pyrobaculum arsenati... [more]
RS12_METKA1.873e-3759.1230S ribosomal protein S12P OS=Methanopyrus kandler... [more]
RS12_THEVO3.195e-3757.3530S ribosomal protein S12P OS=Thermoplasma volcani... [more]
RS12_THECE3.195e-3757.2430S ribosomal protein S12P OS=Thermococcus celer G... [more]
RS12_THEAC4.173e-3757.3530S ribosomal protein S12P OS=Thermoplasma acidoph... [more]
RS23_ENCCU5.450e-3758.8240S ribosomal protein S23 OS=Encephalitozoon cunic... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935508 ID=CK935508|Name=CK935508|organism=Citrus sinensis|type=EST|length=718bp
GGAGGAGGGTTTTGGCNNNTTACTCGCGGCGTCCTCTTGCAACTCTCAAG
CTCCAAAGTCGTTCGTTACAGTAAAAAATCCTCTTCGTAACGCCAACATG
AGGAAGACACGTGGAATGGGAGCTGGTCGCAAGCTGAAGAGCCACCGCAG
AAGACAAAGGTGGGCTGATAAGTCATACAAGAAATCCCACCTTGGCAATG
AATGGAAGAAGCCATTTGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTT
GAGAAAATCGGTATCGAGGCAAAGCAGCCCAACTCTGCTATCAGAAAATG
CGCTCGAGTTCAGCTGATCAAGAATGGAAAGAAGATTGCAGCTTTCGTAC
CAAACGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTACTTATT
GCAGGATTTGGTCGAAAGGGGCATGCTGTGGGAGATATTCCTGGTGTTAG
ATTTAAGGTTGTCAAGGTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGG
AGAAGAAGGAGAAACCAAGATCCTAAACTCCTGATTCAAGATACTTCACC
ATGTTTTCTTTTTTTAGCACTTTATTTTCATTAGTCCCTGTTGATTACTT
TTTTCCTTTATCATGTATTGCTGTTGTGAGAACTTTTTGGTTTTTTTCCC
TCTGTTGAGACTGTTAGTAAATTAGTATCTGTCTCTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
back to top