CK935508

Overview
NameCK935508
Unique NameCK935508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METM7 (30S ribosomal protein S12P OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps12p PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.218e-30
Identity = 71/143 (49.65%), Postives = 93/143 (65.03%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            A  +  +G  AGRKL   RR  RW    Y    L  + K  P  G+   +GIV+EK+G+EAKQPNSAIRKC RVQLIKNG+++ AF P +  +N+I+E+DEV+I G  G  G A GDIPGVR+KVV V   S+  L + ++EK
Sbjct:    2 AGSKSPKGEFAGRKLLLKRRASRWHHYKYVNKALSLKLKADPLEGAPMGRGIVVEKVGLEAKQPNSAIRKCVRVQLIKNGRQVTAFAPGNHAINFIDEHDEVVIEGIGGPSGQAKGDIPGVRYKVVMVGKNSIRELVRGRQEK 144          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METMP (30S ribosomal protein S12P OS=Methanococcus maripaludis GN=rps12p PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.941e-30
Identity = 70/143 (48.95%), Postives = 93/143 (65.03%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            A  +  +G  AGRKL   R+  RW    Y    L  + K  P  G+   +GIV+EK+G+EAKQPNSAIRKC RVQLIKNG+++ AF P +  +N+I+E+DEV+I G  G  G A GDIPGVR+KVV V   S+  L + ++EK
Sbjct:    2 AGSKSPKGEFAGRKLLLKRKASRWHHYKYVNKALSLKLKADPLEGAPMGRGIVIEKVGLEAKQPNSAIRKCVRVQLIKNGRQVTAFAPGNHAINFIDEHDEVVIEGIGGPSGQAKGDIPGVRYKVVLVGKNSIRELVRGRQEK 144          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METM5 (30S ribosomal protein S12P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps12p PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.941e-30
Identity = 70/143 (48.95%), Postives = 93/143 (65.03%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            A  +  +G  AGRKL   R+  RW    Y    L  + K  P  G+   +GIV+EK+G+EAKQPNSAIRKC RVQLIKNG+++ AF P +  +N+I+E+DEV+I G  G  G A GDIPGVR+KVV V   S+  L + ++EK
Sbjct:    2 AGSKSPKGEFAGRKLLLKRKASRWHHYKYVNKALSLKLKADPLEGAPMGRGIVVEKVGLEAKQPNSAIRKCVRVQLIKNGRQVTAFAPGNHAINFIDEHDEVVIEGIGGPSGQAKGDIPGVRYKVVMVGKNSIRELVRGRQEK 144          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METLZ (30S ribosomal protein S12P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps12p PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.453e-30
Identity = 71/139 (51.08%), Postives = 92/139 (66.19%), Query Frame = 2
Query:  110 RGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +G  A R L    ++ RW+D  Y +  L  + K  P  G+   + IVLEK+G+EAKQPNSAIRKC RVQLIKNG+++ AF   DG +N+I+E+DEV I G  GR G ++GDIPGVRF V  V+GVSL  L   + EK R
Sbjct:    3 QGKFAARNLVRTAKKFRWSDSVYSRRALKLKLKADPLEGAPIGRAIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRQVTAFAVGDGAINFIDEHDEVTICGIGGRAGRSMGDIPGVRFVVSGVNGVSLNELVIGRAEKAR 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METJA (30S ribosomal protein S12P OS=Methanocaldococcus jannaschii GN=rps12p PE=3 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 1.101e-29
Identity = 70/141 (49.65%), Postives = 96/141 (68.09%), Query Frame = 2
Query:  101 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFG--RKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            +  RG  AGRKL+  R+  RW D +Y +  L  + K  P  G+  A+GIV+EK+G+EAKQPNSAIRKC RVQLIKNG+ + AF P +  +N+I+E+DEV+I G G  +   A GDIPGV++KV+ V   SL  L + ++EK
Sbjct:    5 KSPRGEFAGRKLRLKRKWCRWHDYNYVRRVLKLKEKYDPLEGAPMARGIVIEKVGLEAKQPNSAIRKCVRVQLIKNGRVVTAFCPGNHAINFIDEHDEVIIEGIGGPKGPRAKGDIPGVKYKVIMVGRNSLRELVRGRQEK 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METVS (30S ribosomal protein S12P OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps12p PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.877e-29
Identity = 68/140 (48.57%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  101 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            +  +G  AGRKL   R+  RW    Y    LG + K  P  G+   +GIV+EK+G+EAKQPNSAIRKC +VQLIKNG+ + AF P +  +N+I+E+DEV+I G  G  G A GDIPGVR+KV+ V   S+  L + ++EK
Sbjct:    5 KSPKGEFAGRKLLLKRKATRWQHYKYVNRELGLKVKADPLGGAPMGRGIVVEKVGLEAKQPNSAIRKCVKVQLIKNGRVVTAFAPGNHAINFIDEHDEVVIEGIGGPSGQAKGDIPGVRYKVLMVGKNSIRELVRGRQEK 144          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_META3 (30S ribosomal protein S12P OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps12p PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.202e-29
Identity = 68/142 (47.89%), Postives = 91/142 (64.08%), Query Frame = 2
Query:  101 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +  +G  AGRK+   R+  RW    Y    L   E   P  G+   +GIV+EK+G+EAKQPNSAIRKC +VQLIKNG+ + AF P +  +N+I+E+DEV+I G  G  G A GDIPGVRF+VV V   S+  L + ++EK R
Sbjct:    5 KSPKGEFAGRKIVLKRKESRWHHYKYVNKALKLKEKSDPLGGAPMGRGIVVEKVGLEAKQPNSAIRKCVKVQLIKNGRVVTAFAPGNHAINFIDEHDEVVIEGIGGPSGQAKGDIPGVRFRVVMVGKNSMRELVRGRQEKVR 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_NANEQ (30S ribosomal protein S12P OS=Nanoarchaeum equitans GN=rps12p PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.345e-27
Identity = 71/138 (51.45%), Postives = 88/138 (63.77%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G+ AGRKLK  R++ RW D  Y +  L  + K  P  G+  A GIVLEK  +E +QPNS   K  RVQL KNGK + AF P DG +  I+E+DEVLI G  GR+G ++GDIPGVR+KV  V+G  L  L K K EK R
Sbjct:    5 GLFAGRKLKKIRKKFRWNDYRYVRRMLRIKEKYDPLEGAPMASGIVLEKTDVERRQPNSGRIKVVRVQLKKNGKVVTAFTPGDGAIKVIDEHDEVLIVGIRGRQGRSMGDIPGVRYKVYLVNGQPLELLRKGKIEKAR 142          
The following BLAST results are available for this feature:
BLAST of CK935508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS12_METM72.218e-3049.6530S ribosomal protein S12P OS=Methanococcus maripa... [more]
RS12_METMP4.941e-3048.9530S ribosomal protein S12P OS=Methanococcus maripa... [more]
RS12_METM54.941e-3048.9530S ribosomal protein S12P OS=Methanococcus maripa... [more]
RS12_METLZ6.453e-3051.0830S ribosomal protein S12P OS=Methanocorpusculum l... [more]
RS12_METJA1.101e-2949.6530S ribosomal protein S12P OS=Methanocaldococcus j... [more]
RS12_METVS1.877e-2948.5730S ribosomal protein S12P OS=Methanococcus vannie... [more]
RS12_META33.202e-2947.8930S ribosomal protein S12P OS=Methanococcus aeolic... [more]
RS12_NANEQ1.345e-2751.4530S ribosomal protein S12P OS=Nanoarchaeum equitan... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935508 ID=CK935508|Name=CK935508|organism=Citrus sinensis|type=EST|length=718bp
GGAGGAGGGTTTTGGCNNNTTACTCGCGGCGTCCTCTTGCAACTCTCAAG
CTCCAAAGTCGTTCGTTACAGTAAAAAATCCTCTTCGTAACGCCAACATG
AGGAAGACACGTGGAATGGGAGCTGGTCGCAAGCTGAAGAGCCACCGCAG
AAGACAAAGGTGGGCTGATAAGTCATACAAGAAATCCCACCTTGGCAATG
AATGGAAGAAGCCATTTGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTT
GAGAAAATCGGTATCGAGGCAAAGCAGCCCAACTCTGCTATCAGAAAATG
CGCTCGAGTTCAGCTGATCAAGAATGGAAAGAAGATTGCAGCTTTCGTAC
CAAACGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTACTTATT
GCAGGATTTGGTCGAAAGGGGCATGCTGTGGGAGATATTCCTGGTGTTAG
ATTTAAGGTTGTCAAGGTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGG
AGAAGAAGGAGAAACCAAGATCCTAAACTCCTGATTCAAGATACTTCACC
ATGTTTTCTTTTTTTAGCACTTTATTTTCATTAGTCCCTGTTGATTACTT
TTTTCCTTTATCATGTATTGCTGTTGTGAGAACTTTTTGGTTTTTTTCCC
TCTGTTGAGACTGTTAGTAAATTAGTATCTGTCTCTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
back to top