EY736111
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY736111 vs. ExPASy Swiss-Prot
Match: RBS2_THIFE (Ribulose bisphosphate carboxylase small chain 2 OS=Thiobacillus ferrooxidans GN=cbbS2 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.444e-11 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 3 Query: 225 KFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKE 452 KFETLSYLP L+ + + ++++Y++ GW P +E H+ P G YW MWKLPM+G TD +LKE Sbjct: 18 KFETLSYLPALTADEIRQQVAYIVSKGWNPAVE------------HTEPENAFGNYWYMWKLPMFGETDVDTILKE 81 HSP 2 Score: 21.557 bits (44), Expect = 1.444e-11 Identity = 10/25 (40.00%), Postives = 15/25 (60.00%), Query Frame = 1 Query: 469 KEYPHSFVRIIGX*HKRQVQCISFL 543 K PH+ VRI+G + +Q Q S + Sbjct: 87 KRNPHNHVRIVGYDNFKQSQGTSLV 111 The following BLAST results are available for this feature:
BLAST of EY736111 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 111
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY736111 ID=EY736111; Name=EY736111; organism=Citrus sinensis; type=EST; length=889bpback to top |