EY756567
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: YPRB2_CORML (Uncharacterized protein in proB 3'region OS=Corynebacterium melassecola PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 9.733e-11 Identity = 40/120 (33.33%), Postives = 66/120 (55.00%), Query Frame = 1 Query: 439 EGKTVGTVGCGRIGKLLLQRLKPFNCNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798 + KTV +G G IG LL+ LKPFN + + + ET A + + + + D+ V+ PLT+ T + + + + KMK ++VN RG +++T +VDA ++G IAG + DV Sbjct: 125 DNKTVAILGAGGIGVRLLEMLKPFNVKTIAVNNSGRPVEGADETFAM--DKAEHVWAEADVFVLILPLTDATYQIVNAETLGKMKPSAVLVNVGRGPLINTDDLVDALNNGTIAGAALDV 242 HSP 2 Score: 21.1718 bits (43), Expect = 9.733e-11 Identity = 8/18 (44.44%), Postives = 10/18 (55.56%), Query Frame = 2 Query: 824 HPWRYMPNQAMTPHVSGT 877 HP M N +TPH + T Sbjct: 252 HPLWEMDNVVITPHTANT 269 The following BLAST results are available for this feature:
BLAST of EY756567 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 231
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756567 ID=EY756567; Name=EY756567; organism=Citrus sinensis; type=EST; length=916bpback to top |