EY756484
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756484 vs. ExPASy Swiss-Prot
Match: NLTP_AMACA (Non-specific lipid-transfer protein OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.897e-12 Identity = 35/80 (43.75%), Postives = 48/80 (60.00%), Query Frame = 2 Query: 128 IVYLRSGGPIPVP--CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKITISSDCSKVR 361 + YL+ G P P CC GVRSL AAA+T DR+ ACNC+K AA +LN A L CGV + Y ++ + +C+ V+ Sbjct: 15 MTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94 HSP 2 Score: 22.3274 bits (46), Expect = 4.897e-12 Identity = 9/19 (47.37%), Postives = 12/19 (63.16%), Query Frame = 1 Query: 85 AITCGQVTGSLAPCNRLLE 141 A+TC VT +L PC L+ Sbjct: 1 AVTCTVVTKALGPCMTYLK 19
BLAST of EY756484 vs. ExPASy Swiss-Prot
Match: NLTP1_AMAHP (Non-specific lipid-transfer protein 1 OS=Amaranthus hypochondriacus PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.897e-12 Identity = 35/80 (43.75%), Postives = 48/80 (60.00%), Query Frame = 2 Query: 128 IVYLRSGGPIPVP--CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKITISSDCSKVR 361 + YL+ G P P CC GVRSL AAA+T DR+ ACNC+K AA +LN A L CGV + Y ++ + +C+ V+ Sbjct: 15 MTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94 HSP 2 Score: 22.3274 bits (46), Expect = 4.897e-12 Identity = 9/19 (47.37%), Postives = 12/19 (63.16%), Query Frame = 1 Query: 85 AITCGQVTGSLAPCNRLLE 141 A+TC VT +L PC L+ Sbjct: 1 AVTCTVVTKALGPCMTYLK 19 The following BLAST results are available for this feature:
BLAST of EY756484 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756484 ID=EY756484; Name=EY756484; organism=Citrus sinensis; type=EST; length=605bpback to top |