EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.330e-49
Identity = 88/120 (73.33%), Postives = 94/120 (78.33%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI+K L E+  P+GISDWNSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKK  EE  ATTGEGL+WGVL  FGPGLTV+TVVL SVPI+A
Sbjct:  274 PGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGPAILDQVEEKLELKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKCAEEGMATTGEGLEWGVLFGFGPGLTVETVVLRSVPIKA 393          

HSP 2 Score: 40.0466 bits (92), Expect = 2.330e-49
Identity = 27/58 (46.55%), Postives = 30/58 (51.72%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +         LDSL GQ LF  GAA VI  A  D   ER + Q
Sbjct:  183 NRGARVLVVCSEITAVTFRGPVDTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQ 240          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS4_SORBI (Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.958e-49
Identity = 85/118 (72.03%), Postives = 96/118 (81.36%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L E+  PLGI+D+NSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+ +ATTGEGLDWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 41.2022 bits (95), Expect = 3.958e-49
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  A  D   ER + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.142e-48
Identity = 84/118 (71.19%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L ++  PLGISDWNSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+  E+ ++TTGEGLDWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  275 PGLISKNIERALEDAFEPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKARMRATRHVLSEYGNMSSACVLFILDEMRKRPAEDGQSTTGEGLDWGVLFGFGPGLTVETVVLHSVPI 392          

HSP 2 Score: 38.891 bits (89), Expect = 1.142e-48
Identity = 26/58 (44.83%), Postives = 30/58 (51.72%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   +DSL GQ LF  GAA   G A  D   ER + Q
Sbjct:  184 NRGARVMVVCSEITAVTFRGPSESHVDSLVGQALFGDGAAAGRGGADPDGRVERPLFQ 241          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS6_SORBI (Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.142e-48
Identity = 84/118 (71.19%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L E+  PLGI+D+NSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+ +ATTGEG DWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 41.2022 bits (95), Expect = 1.142e-48
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  A  D   ER + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS5_SORBI (Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.142e-48
Identity = 84/118 (71.19%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L E+  PLGI+D+NSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+ +ATTGEG DWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 41.2022 bits (95), Expect = 1.142e-48
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  A  D   ER + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_SORBI (Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.142e-48
Identity = 84/118 (71.19%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L E+  PLGI+D+NSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+ +ATTGEG DWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERLRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 41.2022 bits (95), Expect = 1.142e-48
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  A  D   ER + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS8_BROFI (Chalcone synthase 8 OS=Bromheadia finlaysoniana GN=CHS8 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.489e-48
Identity = 81/118 (68.64%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+KCL ++  PLG+ DWNSIFWIAHPGGPAILDQVE           A+R VL+EYGNMSSACVLFILDEMR++S E  +ATTGEGL+WGVL  FGPGLTV+T+VL SVPI
Sbjct:  273 PGLISKNIQKCLLDAFKPLGVHDWNSIFWIAHPGGPAILDQVEIKLGLKAEKLAASRNVLAEYGNMSSACVLFILDEMRRRSAEAGQATTGEGLEWGVLFGFGPGLTVETIVLRSVPI 390          

HSP 2 Score: 43.8986 bits (102), Expect = 1.489e-48
Identity = 27/58 (46.55%), Postives = 33/58 (56.90%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA +I  +  D+ TER + Q
Sbjct:  182 NAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPDSATERPLFQ 239          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS4_BROFI (Chalcone synthase 4 OS=Bromheadia finlaysoniana GN=CHS4 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.489e-48
Identity = 81/118 (68.64%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+KCL ++  PLG+ DWNSIFWIAHPGGPAILDQVE           A+R VL+EYGNMSSACVLFILDEMR++S E  +ATTGEGL+WGVL  FGPGLTV+T+VL SVPI
Sbjct:  273 PGLISKNIQKCLLDAFKPLGVHDWNSIFWIAHPGGPAILDQVEIKLGLKAEKLAASRSVLAEYGNMSSACVLFILDEMRRRSAEAGQATTGEGLEWGVLFGFGPGLTVETIVLRSVPI 390          

HSP 2 Score: 43.8986 bits (102), Expect = 1.489e-48
Identity = 27/58 (46.55%), Postives = 33/58 (56.90%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA +I  +  D+ TER + Q
Sbjct:  182 NAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPDSATERPLFQ 239          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_BROFI (Chalcone synthase 3 OS=Bromheadia finlaysoniana GN=CHS3 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.489e-48
Identity = 81/118 (68.64%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+KCL ++  PLG+ DWNSIFWIAHPGGPAILDQVE           A+R VL+EYGNMSSACVLFILDEMR++S E  +ATTGEGL+WGVL  FGPGLTV+T+VL SVPI
Sbjct:  273 PGLISKNIQKCLLDAFKPLGVHDWNSIFWIAHPGGPAILDQVEIKLGLKAEKLAASRNVLAEYGNMSSACVLFILDEMRRRSAEAGQATTGEGLEWGVLFGFGPGLTVETIVLRSVPI 390          

HSP 2 Score: 43.8986 bits (102), Expect = 1.489e-48
Identity = 27/58 (46.55%), Postives = 33/58 (56.90%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA +I  +  D+ TER + Q
Sbjct:  182 NAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPDSATERPLFQ 239          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_SORBI (Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.529e-48
Identity = 83/118 (70.34%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L E+  PLGI+D+NSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+ +ATTGEG +WGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGRATTGEGFEWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 41.2022 bits (95), Expect = 2.529e-48
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  A  D   ER + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQ 242          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHS3_RUTGR2.330e-4973.33Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHS4_SORBI3.958e-4972.03Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=... [more]
CHS1_MAIZE1.142e-4871.19Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]
CHS6_SORBI1.142e-4871.19Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=... [more]
CHS5_SORBI1.142e-4871.19Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=... [more]
CHS3_SORBI1.142e-4871.19Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=... [more]
CHS8_BROFI1.489e-4868.64Chalcone synthase 8 OS=Bromheadia finlaysoniana GN... [more]
CHS4_BROFI1.489e-4868.64Chalcone synthase 4 OS=Bromheadia finlaysoniana GN... [more]
CHS3_BROFI1.489e-4868.64Chalcone synthase 3 OS=Bromheadia finlaysoniana GN... [more]
CHS2_SORBI2.529e-4870.34Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top