EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSA_IPOPL (Chalcone synthase A (Fragment) OS=Ipomoea platensis GN=CHSA PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.656e-21
Identity = 49/90 (54.44%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  277 CYRYHPGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEE 546
            C +  P  I  N++ CL ++  P GISDWNSIFWI HPGG AILD+VE           A+R VLSEYGN++SACVLFILD +R+KS ++
Sbjct:  271 CSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAILDRVEERLGLGPEKLRASRDVLSEYGNLTSACVLFILDLVRRKSKKQ 360          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSB_IPOCO (Chalcone synthase B (Fragment) OS=Ipomoea cordatotriloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.689e-21
Identity = 48/90 (53.33%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  277 CYRYHPGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEE 546
            C +  P +I  N++ CL ++  P GISDWNSIFW+ HPGG AI+D VE           A+R VLS YGN++SACVLFILDE+RKKS ++
Sbjct:  273 CSKAVPTFITQNVEDCLVKAFEPYGISDWNSIFWVLHPGGNAIVDGVEETLGLAPEKLRASRDVLSGYGNLTSACVLFILDEVRKKSKKD 362          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSC_IPOPU (Chalcone synthase C (Fragment) OS=Ipomoea purpurea GN=CHSC PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.450e-17
Identity = 43/78 (55.13%), Postives = 51/78 (65.38%), Query Frame = 1
Query:  277 CYRYHPGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLF 510
            C +  P  I  NI+ CL ++  P GISDWNSIFWI HPGG AILD VE           A+R VLS+YGN++SACVLF
Sbjct:  273 CSKAVPSLITQNIEDCLVKAFEPFGISDWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLF 350          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSA_IPONI (Chalcone synthase A (Fragment) OS=Ipomoea nil GN=CHSA PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.367e-14
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  277 CYRYHPGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSAC 501
            C +  P  I  N++  L ++  P GISDWNSIFWI HPGG AILD+VE           A+R VLSE GN++SAC
Sbjct:  270 CSKAVPSLITQNVEDYLVKAFEPFGISDWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASRDVLSESGNLTSAC 344          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHSA_IPOPL1.656e-2154.44Chalcone synthase A (Fragment) OS=Ipomoea platensi... [more]
CHSB_IPOCO3.689e-2153.33Chalcone synthase B (Fragment) OS=Ipomoea cordatot... [more]
CHSC_IPOPU1.450e-1755.13Chalcone synthase C (Fragment) OS=Ipomoea purpurea... [more]
CHSA_IPONI4.367e-1450.67Chalcone synthase A (Fragment) OS=Ipomoea nil GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top