EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_SORBI (Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.529e-48
Identity = 83/118 (70.34%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L E+  PLGI+D+NSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+ + TTGEG DWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIERALEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQTTTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 41.2022 bits (95), Expect = 2.529e-48
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  A  D   ER + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: THS1_VITVI (Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE=1 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 2.530e-48
Identity = 85/117 (72.65%), Postives = 94/117 (80.34%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            P  I  NI+KCL ++  PLGISDWNS+FWIAHPGGPAILD VE+          ATR VLSEYGNMSSACVLFILDEMRKKS++  KATTGEGLDWGVL  FGPGLT++TVVLHSVP
Sbjct:  272 PTLISENIEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGEKATTGEGLDWGVLFGFGPGLTIETVVLHSVP 388          

HSP 2 Score: 37.7354 bits (86), Expect = 2.530e-48
Identity = 25/58 (43.10%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  G++ VI  +  D   ER + Q
Sbjct:  181 NAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAVIVGSDPDVSIERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: THS2_VITVI (Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT00004047001 PE=2 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 3.297e-48
Identity = 83/118 (70.34%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            P  I  NI+KCL ++  PLGISDWNS+FWIAHPGGPAILD VE+          ATR VLSEYGNMSSACVLFILDEMRKKS++  +ATTGEGLDWGVL  FGPGLT++TVVLHS+P+
Sbjct:  272 PTLISENIEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLDKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGERATTGEGLDWGVLFGFGPGLTIETVVLHSIPM 389          

HSP 2 Score: 38.5058 bits (88), Expect = 3.297e-48
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  G+A VI  +  D   ER + Q
Sbjct:  181 NAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS7_SORBI (Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.296e-48
Identity = 85/118 (72.03%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L E+  PLGI+D+NSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S EE +ATTGEG DWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEEGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 38.1206 bits (87), Expect = 4.296e-48
Identity = 26/58 (44.83%), Postives = 30/58 (51.72%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  A  D   E  + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDKRVECPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: THS3_VITVI (Stilbene synthase 3 (Fragment) OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 4.297e-48
Identity = 83/118 (70.34%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            P  I  N++KCL ++  PLGISDWNS+FWIAHPGGPAILD VE+          ATR VLSEYGNMSSACVLFILDEMRKKS +  KATTGEGLDWGVL  FGPGLT++TVVLHS+P+
Sbjct:  269 PTLISENVEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLDKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSHKGEKATTGEGLDWGVLFGFGPGLTIETVVLHSIPM 386          

HSP 2 Score: 38.891 bits (89), Expect = 4.297e-48
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  G+A VI  +  D   ER + Q
Sbjct:  178 NAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQ 235          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_GERHY (Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.600e-48
Identity = 84/117 (71.79%), Postives = 90/117 (76.92%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            PG I  NI+K L  +  PLGI+DWNSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFI+DEMRKKS E    TTGEGL+WGVL  FGPGLTV+TVVLHSVP
Sbjct:  275 PGLISKNIEKALTTAFSPLGINDWNSIFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFIIDEMRKKSSENGAGTTGEGLEWGVLFGFGPGLTVETVVLHSVP 391          

HSP 2 Score: 41.5874 bits (96), Expect = 5.600e-48
Identity = 26/56 (46.43%), Postives = 31/56 (55.36%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N GARV+ VCSE   +     +   LDSL GQ LF  GAA VI  +  D  TER +
Sbjct:  184 NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPDLTTERPL 239          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_SECCE (Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 7.299e-48
Identity = 81/120 (67.50%), Postives = 93/120 (77.50%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI++ L ++  PLGI DWNS+FWIAHPGGPAILD VE+          ATR VLSEYGNMSSACVLFI+DEMRK+S E+   TTGEG+DWGVL  FGPGLTV+TVVLHSVP+ A
Sbjct:  275 PGLISKNIERALEDAFKPLGIDDWNSVFWIAHPGGPAILDMVEAKVNLNKERMRATRHVLSEYGNMSSACVLFIMDEMRKRSAEDGHTTTGEGMDWGVLFGFGPGLTVETVVLHSVPVTA 394          

HSP 2 Score: 39.6614 bits (91), Expect = 7.299e-48
Identity = 27/58 (46.55%), Postives = 30/58 (51.72%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +         LDSL GQ LF  GAA VI  A  D   ER + Q
Sbjct:  184 NRGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAVIIGADPDESIERPLFQ 241          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: THS5_VITVI (Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 9.514e-48
Identity = 84/118 (71.19%), Postives = 96/118 (81.36%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            P  I  NI+KCL+++  PLGIS+WNS+FWIAHPGGPAILD VE+          ATR VLSEYGNMSSACVLFILDEMRKKS++  KATTGEGLDWGVL  FGPGLT++TVVLHSVP+
Sbjct:  272 PTLISENIEKCLSQAFDPLGISNWNSLFWIAHPGGPAILDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGEKATTGEGLDWGVLFGFGPGLTIETVVLHSVPM 389          

HSP 2 Score: 36.965 bits (84), Expect = 9.514e-48
Identity = 25/58 (43.10%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  G+A VI  +  +   ER + Q
Sbjct:  181 NAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPNVSIERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: THS7_VITVI (Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.240e-47
Identity = 83/117 (70.94%), Postives = 93/117 (79.49%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            P  I  NI+KCL ++  PLGISDWNS+FWIAHPGGPAILD VE+          ATR VLSEYGNMSSACVLFILDEMRKKS++   ATTGEGLDWGVL  FGPGLT++TVVLHS+P
Sbjct:  272 PTLISENIEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGENATTGEGLDWGVLFGFGPGLTIETVVLHSIP 388          

HSP 2 Score: 37.7354 bits (86), Expect = 1.240e-47
Identity = 25/58 (43.10%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  G++ VI  +  D   ER + Q
Sbjct:  181 NAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAVIVGSDPDVSIERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_HORVU (Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 3.577e-47
Identity = 82/120 (68.33%), Postives = 92/120 (76.67%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI++ L E+  PLGI  WNS+FWIAH GGPAILD VE+          ATR VLSEYGNMSSACVLFI+DEMRK+S E+  ATTGEG+DWGVL  FGPGLTV+TVVLHSVPI A
Sbjct:  275 PGLISKNIERALEEAFKPLGIDHWNSVFWIAHQGGPAILDMVEAKVNLNKERMRATRHVLSEYGNMSSACVLFIMDEMRKRSAEDGHATTGEGMDWGVLFGFGPGLTVETVVLHSVPISA 394          

HSP 2 Score: 40.0466 bits (92), Expect = 3.577e-47
Identity = 27/58 (46.55%), Postives = 30/58 (51.72%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +         LDSL GQ LF  GAA VI  A  D   ER + Q
Sbjct:  184 NRGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAVIIGADPDLSVERPLFQ 241          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHS1_SORBI2.529e-4870.34Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=... [more]
THS1_VITVI2.530e-4872.65Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE... [more]
THS2_VITVI3.297e-4870.34Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT000... [more]
CHS7_SORBI4.296e-4872.03Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=... [more]
THS3_VITVI4.297e-4870.34Stilbene synthase 3 (Fragment) OS=Vitis vinifera P... [more]
CHS1_GERHY5.600e-4871.79Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=... [more]
CHS2_SECCE7.299e-4867.50Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2... [more]
THS5_VITVI9.514e-4871.19Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT000... [more]
THS7_VITVI1.240e-4770.94Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 ... [more]
CHS1_HORVU3.577e-4768.33Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top