EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: ACS3_RUTGR (Probable acridone synthase 3 OS=Ruta graveolens GN=ACS3 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 5.945e-44
Identity = 77/120 (64.17%), Postives = 91/120 (75.83%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            P     NI   L E+  PLGISDWNSIFWIAHPGGPAILDQ+E           A++ V+SEYGNMSS+CVLF+LDEMR +S+++ K+TTGEGLDWGVL  FGPGLTV+T+VL SVPI A
Sbjct:  272 PALFSGNIDTPLVEAFKPLGISDWNSIFWIAHPGGPAILDQIEEKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRSRSLQDGKSTTGEGLDWGVLFGFGPGLTVETIVLRSVPIEA 391          

HSP 2 Score: 35.4242 bits (80), Expect = 5.945e-44
Identity = 23/56 (41.07%), Postives = 30/56 (53.57%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N G+RV+ VCSE         S   +DSL GQ LF  GAA ++  A  D+  ER +
Sbjct:  181 NKGSRVLVVCSELTAPTFRGPSPDAVDSLVGQALFADGAAALVVGADPDSSIERAL 236          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_ANTMA (Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 9.022e-44
Identity = 86/118 (72.88%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           +TRQVLSEYGNMSSACVLFILDEMRK S +E  +TTGEGLDWGVL  FGPGLTV+TVVLHSVP+
Sbjct:  272 PGLISKNIEKSLKEAFDPLGISDWNSVFWIAHPGGPAILDQVEEKLGLKPEKLRSTRQVLSEYGNMSSACVLFILDEMRKSSAKEGMSTTGEGLDWGVLFGFGPGLTVETVVLHSVPL 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_SINAL (Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.010e-43
Identity = 86/118 (72.88%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILD VE           ATR VLSEYGNMSSACVLFILDEMR+KSVE+  ATTGEGL+WGVL  FGPGLTV+TVVLHSVP+
Sbjct:  278 PGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSVEDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPV 395          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_ARAAL (Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 3.428e-43
Identity = 86/118 (72.88%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS ++  ATTGEGL+WGVL  FGPGLTV+TVVLHSVP+
Sbjct:  274 PGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAKDGAATTGEGLEWGVLFGFGPGLTVETVVLHSVPL 391          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 4.478e-43
Identity = 85/116 (73.28%), Postives = 93/116 (80.17%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  P+GISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS+EE K +TGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGSTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_HORVU (Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 8.392e-43
Identity = 76/118 (64.41%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI++ L ++  PLGI +WNSIFWIAHPGGPAILD+VE           A+R+VLSEYGNMSSA VLF+LD MRK S ++  ATTGEG DWGVL  FGPGLTV+T+VLHSVP+
Sbjct:  274 PGLISENIEQALEDAFEPLGIHNWNSIFWIAHPGGPAILDRVEDRVGLDKKRMRASREVLSEYGNMSSASVLFVLDVMRKSSAKDGLATTGEGKDWGVLFGFGPGLTVETLVLHSVPV 391          

HSP 2 Score: 36.965 bits (84), Expect = 8.392e-43
Identity = 26/59 (44.07%), Postives = 31/59 (52.54%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGI-LSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +    PC    LDSL G  LF  GAA  I  A  D + E+ + Q
Sbjct:  183 NRGARVLVVCSEITAMAFRGPCK-SHLDSLVGHALFGDGAAAAIIGADPDQLDEQPVFQ 240          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 9.975e-43
Identity = 84/118 (71.19%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILD VE           ATR VLSEYGNMSSACVLFILDEMR+KS+++  ATTGEGL+WGVL  FGPGLTV+TVVLHSVP+
Sbjct:  277 PGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSLDDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPV 394          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_SINAL (Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 9.975e-43
Identity = 85/118 (72.03%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILD VE           ATR VLSEYGNMSSACVLFILDEMR+KS E+  ATTGEGL+WGVL  FGPGLTV+TVVLHSVP+
Sbjct:  278 PGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPV 395          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_PERFR (Chalcone synthase OS=Perilla frutescens GN=CHS PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.702e-42
Identity = 84/118 (71.19%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE+          +TR VL EYGNMSSACVLFILDEMRK S +E  ++TGEGLDWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  272 PGLISKNIEKSLKEAFGPLGISDWNSVFWIAHPGGPAILDQVEAKLGLKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKEGMSSTGEGLDWGVLFGFGPGLTVETVVLHSVPI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_MATIN (Chalcone synthase OS=Matthiola incana GN=CHS PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.222e-42
Identity = 85/118 (72.03%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS ++  ATTGEGL+WGVL  FGPGLTV+TVVL SVP+
Sbjct:  277 PGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAQDGVATTGEGLEWGVLFGFGPGLTVETVVLRSVPL 394          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
ACS3_RUTGR5.945e-4464.17Probable acridone synthase 3 OS=Ruta graveolens GN... [more]
CHSY_ANTMA9.022e-4472.88Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3... [more]
CHS1_SINAL2.010e-4372.88Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 S... [more]
CHSY_ARAAL3.428e-4372.88Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=... [more]
CHSY_VITVI4.478e-4373.28Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]
CHS2_HORVU8.392e-4364.41Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=... [more]
CHSY_RAPSA9.975e-4371.19Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 ... [more]
CHS3_SINAL9.975e-4372.03Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 S... [more]
CHSY_PERFR1.702e-4271.19Chalcone synthase OS=Perilla frutescens GN=CHS PE=... [more]
CHSY_MATIN2.222e-4272.03Chalcone synthase OS=Matthiola incana GN=CHS PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top