EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_ARATH (Chalcone synthase OS=Arabidopsis thaliana GN=CHS PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.222e-42
Identity = 85/118 (72.03%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMR+KS ++  ATTGEGL+WGVL  FGPGLTV+TVVLHSVP+
Sbjct:  278 PGLISKNIVKSLDEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPL 395          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_DAUCA (Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.222e-42
Identity = 84/117 (71.79%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            PG I  NI+K L E+  PLGISDWNSIFWIAHPGGPAILDQVE+          +TRQVL +YGNMSSACVLFILDEMRK S ++   TTGEGLDWGVL  FGPGLTV+TVVLHSVP
Sbjct:  272 PGLISKNIRKSLVEAFKPLGISDWNSIFWIAHPGGPAILDQVETELSLKPEKLKSTRQVLRDYGNMSSACVLFILDEMRKASAKDGHRTTGEGLDWGVLFGFGPGLTVETVVLHSVP 388          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_CARAN (Chalcone synthase OS=Cardamine amara GN=CHS PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.902e-42
Identity = 84/118 (71.19%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR V+ EYGNMSSACVLFILDEMRKKS ++  ATTGEGL+WGVL  FGPGLTV+TVVLHSVP+
Sbjct:  278 PGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPL 395          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_SOLTU (Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.791e-42
Identity = 86/116 (74.14%), Postives = 92/116 (79.31%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNSIFWIAHPGGPAILDQVE           ATRQVLS+YGNMSSACVLFILDEMRK S +E  +TTGEGLDWGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGPAILDQVELKLGLKPEKLQATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_SOLLC (Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS2 PE=2 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 3.791e-42
Identity = 86/116 (74.14%), Postives = 92/116 (79.31%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNSIFWIAHPGGPAILDQVE           ATRQVLS+YGNMSSACVLFILDEMRK S +E  +TTGEGLDWGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGPAILDQVELKLSLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSD_IPONI (Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.951e-42
Identity = 83/117 (70.94%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            P  +  NI+KCL+E+  PLGISDWNSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S  +   TTGEGL+WGVL  FGPGLT++TVVLHSVP
Sbjct:  271 PSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVP 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_CITSI (Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.951e-42
Identity = 85/116 (73.28%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS E+   T GEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  271 PGLISKNIQKSLTEAFKPLGISDWNSIFWIAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLETAGEGLEWGVLFGFGPGLTVETVVLHSV 386          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_CASGL (Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.951e-42
Identity = 84/116 (72.41%), Postives = 91/116 (78.45%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMR+KS E+   TTGEGLDWGVL  FGPGLTV+TVVLHS+
Sbjct:  272 PGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGPAILDQVEEKLALKPEKLGATRHVLSEYGNMSSACVLFILDEMRRKSAEKGLKTTGEGLDWGVLFGFGPGLTVETVVLHSL 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_HYPAN (Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.466e-42
Identity = 83/118 (70.34%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  N++K L E+  PLGISDWNS+FWIAHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMR+KS E+   TTGEG++WGVL  FGPGLTV+TVVLHSV I
Sbjct:  272 PGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGPAILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEWGVLFGFGPGLTVETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS7_IPOBA (Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-DIII PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.466e-42
Identity = 83/119 (69.75%), Postives = 91/119 (76.47%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIR 648
            P  +  NI+KCL E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S      TTGEGL+WGVL  FGPGLT++TVVLHSVPI+
Sbjct:  271 PSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHSY_ARATH2.222e-4272.03Chalcone synthase OS=Arabidopsis thaliana GN=CHS P... [more]
CHS1_DAUCA2.222e-4271.79Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 ... [more]
CHSY_CARAN2.902e-4271.19Chalcone synthase OS=Cardamine amara GN=CHS PE=3 S... [more]
CHS2_SOLTU3.791e-4274.14Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 P... [more]
CHS2_SOLLC3.791e-4274.14Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS... [more]
CHSD_IPONI4.951e-4270.94Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV... [more]
CHS1_CITSI4.951e-4273.28Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=... [more]
CHS1_CASGL4.951e-4272.41Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2... [more]
CHSY_HYPAN6.466e-4270.34Chalcone synthase OS=Hypericum androsaemum PE=1 SV... [more]
CHS7_IPOBA6.466e-4269.75Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-D... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top