EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS4_IPOBA (Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF4 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.466e-42
Identity = 83/119 (69.75%), Postives = 91/119 (76.47%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIR 648
            P  +  NI+KCL E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S      TTGEGL+WGVL  FGPGLT++TVVLHSVPI+
Sbjct:  271 PSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_IPOBA (Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF2 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.466e-42
Identity = 83/119 (69.75%), Postives = 91/119 (76.47%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIR 648
            P  +  NI+KCL E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S      TTGEGL+WGVL  FGPGLT++TVVLHSVPI+
Sbjct:  271 PSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS9_DAUCA (Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 8.445e-42
Identity = 83/117 (70.94%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            PG I  NI+K L E+  PLGISDWNSIFWIAHPGGPAILDQVE+          +TRQVL +YGNMSSACVLFILDEMR  S ++   TTGEGLDWGVL  FGPGLTV+TVVLHSVP
Sbjct:  272 PGLISKNIRKSLVEAFKPLGISDWNSIFWIAHPGGPAILDQVETELSLKPDKLKSTRQVLRDYGNMSSACVLFILDEMRNASAKDGHRTTGEGLDWGVLFGFGPGLTVETVVLHSVP 388          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_TRISU (Chalcone synthase 3 OS=Trifolium subterraneum GN=CHS3 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.103e-41
Identity = 84/118 (71.19%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGLDWGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSTKDGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_MALDO (Chalcone synthase (Fragment) OS=Malus domestica GN=CHS PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.440e-41
Identity = 82/116 (70.69%), Postives = 94/116 (81.03%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E++ P+GISDWNS+FWIAHPGGPAILDQVE+          ATRQVLS+YGNMSSACVLFILDE+R+KS E+   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  115 PGLISKNIEKSLNEALKPIGISDWNSLFWIAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLETTGEGLEWGVLFGFGPGLTVETVVLHSV 230          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_IPOBA (Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF3 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.440e-41
Identity = 82/117 (70.09%), Postives = 90/117 (76.92%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            P  +  NI+KCL E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S  +   TTGEGL+WGVL  FGPGLT++TVVLHSVP
Sbjct:  271 PSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVP 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_CAMSI (Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.440e-41
Identity = 84/116 (72.41%), Postives = 91/116 (78.45%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K LAE+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS  +   TTGEGL+WGVL  FGPGLTV+TVVLHS+
Sbjct:  272 PGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEWGVLFGFGPGLTVETVVLHSL 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSJ_PETHY (Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=2 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.881e-41
Identity = 85/116 (73.28%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S +E   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIQKSLVEAFQPLGISDWNSIFWIAHPGGPAILDQVELKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS5_SOYBN (Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.881e-41
Identity = 84/118 (71.19%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISD+NSIFWIAHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILD+MRKKS+E    TTGEGLDWGVL  FGPGLTV+TVVL SV +
Sbjct:  271 PGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTV 388          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.881e-41
Identity = 84/118 (71.19%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISD+NSIFWIAHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILD+MRKKS+E    TTGEGLDWGVL  FGPGLTV+TVVL SV +
Sbjct:  271 PGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTV 388          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHS4_IPOBA6.466e-4269.75Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS2_IPOBA6.466e-4269.75Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS9_DAUCA8.445e-4270.94Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 ... [more]
CHS3_TRISU1.103e-4171.19Chalcone synthase 3 OS=Trifolium subterraneum GN=C... [more]
CHSY_MALDO1.440e-4170.69Chalcone synthase (Fragment) OS=Malus domestica GN... [more]
CHS3_IPOBA1.440e-4170.09Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS1_CAMSI1.440e-4172.41Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 P... [more]
CHSJ_PETHY1.881e-4173.28Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=... [more]
CHS5_SOYBN1.881e-4171.19Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV... [more]
CHS3_SOYBN1.881e-4171.19Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top