EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSA_SOLTU (Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.149e-41
Identity = 83/116 (71.55%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR+VLS YGNMSSACVLFILDEMRK S  E   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTNEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.149e-41
Identity = 82/118 (69.49%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGLDWGVL  FGPGLT++TVVLHSV +
Sbjct:  168 PGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQQGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAL 285          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_PEA (Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.149e-41
Identity = 82/118 (69.49%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILD+MRKKS ++   TTGEGL+WGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALVEAFKPLGISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMRATREVLSEYGNMSSACVLFILDQMRKKSTQDGLNTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS9_MEDSA (Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.337e-41
Identity = 83/118 (70.34%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS +    TTGEGLDWGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQAGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS6_PEA (Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.337e-41
Identity = 82/118 (69.49%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL I D+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGLDWGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNINKALVEAFQPLNIDDYNSIFWIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQQGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS6_IPOBA (Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DII PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.337e-41
Identity = 82/119 (68.91%), Postives = 90/119 (75.63%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIR 648
            P  +  NI+KCL E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S      TTGEGL+WGVL  FGPGLT++TVVLHSV I+
Sbjct:  271 PSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVLIK 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS6_TRISU (Chalcone synthase 6 OS=Trifolium subterraneum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.219e-40
Identity = 83/118 (70.34%), Postives = 89/118 (75.42%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS +    TTGEGLDWGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATRDVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS5_TRISU (Chalcone synthase 5 OS=Trifolium subterraneum GN=CHS5 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.219e-40
Identity = 83/118 (70.34%), Postives = 89/118 (75.42%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS +    TTGEGLDWGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATRDVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_MEDSA (Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.219e-40
Identity = 83/118 (70.34%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS +    TTGEGLDWGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALIEAFQPLNISDYNSIFWIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQAGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS7_MEDSA (Chalcone synthase (Fragment) OS=Medicago sativa GN=CHSII PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.593e-40
Identity = 82/118 (69.49%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGL+WGVL  FGPGLT++TVVL SV I
Sbjct:  148 PGIVSKNINKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVTI 265          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHSA_SOLTU7.149e-4171.55Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A... [more]
CHS6_MEDSA7.149e-4169.49Chalcone synthase 6-4 (Fragment) OS=Medicago sativ... [more]
CHS1_PEA7.149e-4169.49Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 ... [more]
CHS9_MEDSA9.337e-4170.34Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=... [more]
CHS6_PEA9.337e-4169.49Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 ... [more]
CHS6_IPOBA9.337e-4168.91Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DI... [more]
CHS6_TRISU1.219e-4070.34Chalcone synthase 6 OS=Trifolium subterraneum GN=C... [more]
CHS5_TRISU1.219e-4070.34Chalcone synthase 5 OS=Trifolium subterraneum GN=C... [more]
CHS3_MEDSA1.219e-4070.34Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1... [more]
CHS7_MEDSA1.593e-4069.49Chalcone synthase (Fragment) OS=Medicago sativa GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top