EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS6_SOYBN (Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.593e-40
Identity = 82/118 (69.49%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGI D+NSIFWIAHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILD+MRKKS+E    TTGEGL+WGVL  FGPGLTV+TVVL SV +
Sbjct:  271 PGLISKNIQKALVEAFQPLGIDDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLEWGVLFGFGPGLTVETVVLRSVTV 388          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS5_MEDSA (Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.593e-40
Identity = 82/118 (69.49%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGL+WGVL  FGPGLT++TVVL SV I
Sbjct:  272 PGIVSKNINKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_HYDMC (Chalcone synthase OS=Hydrangea macrophylla GN=CHS PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.080e-40
Identity = 82/116 (70.69%), Postives = 88/116 (75.86%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PL ISDWNSIFWIAHPGGPAILDQVE           ATR VLS+YGNMSSACVLFI+DEMRK S EE   TTGEGL+WGVL  FGPGLTV+TVVLH V
Sbjct:  272 PGLISKNIEKSLVEAFRPLDISDWNSIFWIAHPGGPAILDQVEKKLALKPEKLRATRNVLSDYGNMSSACVLFIMDEMRKNSAEEGLMTTGEGLEWGVLFGFGPGLTVETVVLHGV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS5_PEA (Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.080e-40
Identity = 81/118 (68.64%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            P  +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMR+KS++    TTGEGL+WGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PAIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRRKSIQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS4_MEDSA (Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=2 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 2.080e-40
Identity = 82/118 (69.49%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGL+WGVL  FGPGLT++TVVL SV I
Sbjct:  272 PGIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMRATREVLSEYGNMSSACVLFILDEMRKKSTQDGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_PEA (Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.080e-40
Identity = 81/118 (68.64%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            P  +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMR+KS++    TTGEGL+WGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PAIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRRKSIQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_TRISU (Chalcone synthase 2 OS=Trifolium subterraneum GN=CHS2 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.080e-40
Identity = 82/118 (69.49%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS +    TTGEGL+WGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.080e-40
Identity = 82/118 (69.49%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGL+WGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLSLKPEKMKATRDVLSEYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS4_PEA (Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.717e-40
Identity = 81/118 (68.64%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            P  +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMR+KS++    TTGEGL+WGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PAIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRRKSIQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVVI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_PEA (Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.717e-40
Identity = 82/118 (69.49%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PLGISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGL+WGVL  FGPGLT++TVVL SV I
Sbjct:  272 PGIVSKNIDKALVEAFKPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMRATREVLSEYGNMSSACVLFILDEMRKKSTQDGLNTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHS6_SOYBN1.593e-4069.49Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV... [more]
CHS5_MEDSA1.593e-4069.49Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2... [more]
CHSY_HYDMC2.080e-4070.69Chalcone synthase OS=Hydrangea macrophylla GN=CHS ... [more]
CHS5_PEA2.080e-4068.64Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 ... [more]
CHS4_MEDSA2.080e-4069.49Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=... [more]
CHS3_PEA2.080e-4068.64Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 ... [more]
CHS2_TRISU2.080e-4069.49Chalcone synthase 2 OS=Trifolium subterraneum GN=C... [more]
CHS1_TRISU2.080e-4069.49Chalcone synthase 1 OS=Trifolium subterraneum GN=C... [more]
CHS4_PEA2.717e-4068.64Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 ... [more]
CHS2_PEA2.717e-4069.49Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top