EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CHLAT (Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.166e-34
Identity = 65/93 (69.89%), Postives = 80/93 (86.02%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   E++MVMPGDR+KMVV+LI P+A E+GMRFAIREGG+TVGAGV+ +I+E
Sbjct:  318 AQVYILNKEEGGRHTPFFQGYRPQFYVRTTDVTGKIESFQADDGSETQMVMPGDRIKMVVQLIQPIAIEKGMRFAIREGGRTVGAGVVFNILE 410          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNJA (Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.695e-34
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG ++S   D   + +MVMPGDRV+M VELI P+A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  317 SEVYVLKKEEGGRHTPFFAGYRPQFYVRTTDVTGTITSFTADDGSKPEMVMPGDRVRMTVELIQPIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROMT (Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.826e-34
Identity = 66/91 (72.53%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELIAPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROM1 (Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.826e-34
Identity = 66/91 (72.53%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELIAPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNPW (Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.303e-34
Identity = 66/91 (72.53%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D   + +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSDVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROM5 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.303e-34
Identity = 66/91 (72.53%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGANVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NEPOL (Elongation factor Tu, chloroplastic OS=Nephroselmis olivacea GN=tufA PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.303e-34
Identity = 67/92 (72.83%), Postives = 78/92 (84.78%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   E+ MVMPGDRVKMVVELI P+A E+GMRFAIREGG+TVGAGV+ +II
Sbjct:  318 SQVYVLTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIDSFRADDGGEATMVMPGDRVKMVVELIQPIAIEKGMRFAIREGGRTVGAGVVSNII 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CHLVU (Elongation factor Tu, chloroplastic OS=Chlorella vulgaris GN=tufA PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.303e-34
Identity = 64/92 (69.57%), Postives = 79/92 (85.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D +  ++MVMPGDR+KM+VELI P+A E+GMRFAIREGG+TVGAGV+ +I+
Sbjct:  317 AQVYVLNKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFRADDNTATQMVMPGDRIKMIVELIQPIAIEKGMRFAIREGGRTVGAGVVSTIV 408          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_LEPTE (Elongation factor Tu, chloroplastic OS=Leptosira terrestris GN=tufA PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.232e-34
Identity = 62/92 (67.39%), Postives = 80/92 (86.96%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VY+L ++EGGRH+PFFAGYRPQFY+RTTDVTG++ +   D D+ ++MVMPGDR+KM VELI P+A E+GMRFAIREGG+TVGAGV+ +I+
Sbjct:  317 AQVYILTRDEGGRHTPFFAGYRPQFYVRTTDVTGKIETFRTDDDQPTQMVMPGDRIKMEVELIQPIAIEKGMRFAIREGGRTVGAGVVSAIV 408          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_OLTVI (Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.075e-33
Identity = 66/92 (71.74%), Postives = 78/92 (84.78%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S + D    S+MVMPGDRVKM+VELI P+A E+GMRFAIREGG+TVGAGV+  I+
Sbjct:  318 AQVYVLTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFVADDGSASQMVMPGDRVKMLVELINPIAVEKGMRFAIREGGRTVGAGVVSEIL 409          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_CHLAT2.166e-3469.89Elongation factor Tu, chloroplastic OS=Chlorokybus... [more]
EFTU_SYNJA3.695e-3470.97Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_PROMT4.826e-3472.53Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROM14.826e-3472.53Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_SYNPW6.303e-3472.53Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_PROM56.303e-3472.53Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_NEPOL6.303e-3472.83Elongation factor Tu, chloroplastic OS=Nephroselmi... [more]
EFTU_CHLVU6.303e-3469.57Elongation factor Tu, chloroplastic OS=Chlorella v... [more]
EFTU_LEPTE8.232e-3467.39Elongation factor Tu, chloroplastic OS=Leptosira t... [more]
EFTU_OLTVI1.075e-3371.74Elongation factor Tu, chloroplastic OS=Oltmannsiel... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top