EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_VIBC3 (Elongation factor Tu OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 60/92 (65.22%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL K+EGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD VKMVV+LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGSI-----ELPEGVEMVMPGDNVKMVVDLIAPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NITSB (Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 61/93 (65.59%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A +YVL KEEGGRH+PFF+GYRPQFY+RTTDVTG ++       E  +MVMPGD VK+  ELI P+A E+G RFAIREGG+TVGAGV+  IIE
Sbjct:  312 AEIYVLTKEEGGRHTPFFSGYRPQFYVRTTDVTGTITL-----PEGVEMVMPGDNVKINAELIAPIALEEGTRFAIREGGRTVGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NEIMF (Elongation factor Tu OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 61/92 (66.30%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG V+      +E  +MVMPG+ V + VELI P+A E+G+RFAIREGG+TVGAGV+ S+I
Sbjct:  307 AEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVTL-----EEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVI 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NEIMB (Elongation factor Tu OS=Neisseria meningitidis serogroup B GN=tufA PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 61/92 (66.30%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG V+      +E  +MVMPG+ V + VELI P+A E+G+RFAIREGG+TVGAGV+ S+I
Sbjct:  307 AEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVTL-----EEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVI 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NEIMA (Elongation factor Tu OS=Neisseria meningitidis serogroup A GN=tufA PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 61/92 (66.30%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG V+      +E  +MVMPG+ V + VELI P+A E+G+RFAIREGG+TVGAGV+ S+I
Sbjct:  307 AEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVTL-----EEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVI 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_GEMAT (Elongation factor Tu OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 59/93 (63.44%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    2 HASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            H+ VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD V+M +ELI+P+A E+ +RFAIREGG+TVGAGV+  I+
Sbjct:  312 HSEVYVLTKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGMEMVMPGDNVQMTIELIIPIAMEEQLRFAIREGGRTVGAGVVTKIL 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CHRVO (Elongation factor Tu OS=Chromobacterium violaceum GN=tuf1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 62/92 (67.39%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            ASVYVL K+EGGRH+PFFA YRPQFY RTTDVTG +S       E  +MVMPGD V++ VELI P+A E+G+RFAIREGG+TVGAGV+  II
Sbjct:  309 ASVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGAISLA-----EGVEMVMPGDNVEIKVELIAPIAMEEGLRFAIREGGRTVGAGVVAKII 395          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_BUCBP (Elongation factor Tu OS=Buchnera aphidicola subsp. Baizongia pistaciae GN=tuf PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 59/93 (63.44%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG V     +  E+ +MVMPGD VKMV+ LI P+A   G+RFAIREGGKTVGAG++  +++
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSV-----ELPEDMEMVMPGDNVKMVITLIHPIAMSDGLRFAIREGGKTVGAGIVVKVLQ 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_AERS4 (Elongation factor Tu OS=Aeromonas salmonicida (strain A449) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A + G+RFAIREGG+TVGAGV+ S+I
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVASVI 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTUL_VIBVU (Putative elongation factor Tu-like protein OS=Vibrio vulnificus GN=VV1_1204 PE=5 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 60/93 (64.52%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL K+EGGRH+PFF GYRPQFY RTTDVTG +S       E  +MVMPGD ++MVVELI P+A ++G+RFAIREGG+TVGAGV+  I E
Sbjct:  216 SEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDISL-----PEGVEMVMPGDNIQMVVELISPIAMDEGLRFAIREGGRTVGAGVVAKIFE 303          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_VIBC31.041e-2865.22Elongation factor Tu OS=Vibrio cholerae serotype O... [more]
EFTU_NITSB1.041e-2865.59Elongation factor Tu OS=Nitratiruptor sp. (strain ... [more]
EFTU_NEIMF1.041e-2866.30Elongation factor Tu OS=Neisseria meningitidis ser... [more]
EFTU_NEIMB1.041e-2866.30Elongation factor Tu OS=Neisseria meningitidis ser... [more]
EFTU_NEIMA1.041e-2866.30Elongation factor Tu OS=Neisseria meningitidis ser... [more]
EFTU_GEMAT1.041e-2863.44Elongation factor Tu OS=Gemmatimonas aurantiaca (s... [more]
EFTU_CHRVO1.041e-2867.39Elongation factor Tu OS=Chromobacterium violaceum ... [more]
EFTU_BUCBP1.041e-2863.44Elongation factor Tu OS=Buchnera aphidicola subsp.... [more]
EFTU_AERS41.041e-2865.22Elongation factor Tu OS=Aeromonas salmonicida (str... [more]
EFTUL_VIBVU1.041e-2864.52Putative elongation factor Tu-like protein OS=Vibr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top