EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_HAES2 (Elongation factor Tu OS=Haemophilus somnus (strain 2336) GN=tuf PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KM V LI P+A +QG+RFAIREGG+TVGAGV+  II+
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_HAES1 (Elongation factor Tu OS=Haemophilus somnus (strain 129Pt) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KM V LI P+A +QG+RFAIREGG+TVGAGV+  II+
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FERNB (Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/93 (64.52%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A++YVLKKEEGGRH+PF  GY+PQFY+RT DVTG +     D     +MVMPGD V+M +ELI PVA E+GMRFA+REGG+TVGAGV+  IIE
Sbjct:  312 ANIYVLKKEEGGRHTPFTKGYKPQFYIRTADVTGEIV----DLPAGVEMVMPGDNVEMTIELIYPVAIEKGMRFAVREGGRTVGAGVVSEIIE 400          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FERIS (Elongation factor Tu OS=Fervidobacterium islandicum GN=tuf PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/93 (64.52%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A++YVLKKEEGGRH+PF  GY+PQFY+RT DVTG +     D     +MVMPGD V+M +ELI PVA E+GMRFA+REGG+TVGAGV+  IIE
Sbjct:  311 ANIYVLKKEEGGRHTPFTKGYKPQFYIRTADVTGEIV----DLPAGVEMVMPGDNVEMTIELIYPVAIEKGMRFAVREGGRTVGAGVVSEIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_DICNV (Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG          E  +MVMPGD VKM+V+LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  309 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGECVL-----PEGVEMVMPGDNVKMIVQLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIE 396          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SHESR (Elongation factor Tu 2 OS=Shewanella sp. (strain MR-7) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SHESM (Elongation factor Tu 2 OS=Shewanella sp. (strain MR-4) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SHEON (Elongation factor Tu 2 OS=Shewanella oneidensis GN=tuf2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SHELP (Elongation factor Tu 2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SHEB9 (Elongation factor Tu 2 OS=Shewanella baltica (strain OS195) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_HAES21.360e-2864.52Elongation factor Tu OS=Haemophilus somnus (strain... [more]
EFTU_HAES11.360e-2864.52Elongation factor Tu OS=Haemophilus somnus (strain... [more]
EFTU_FERNB1.360e-2864.52Elongation factor Tu OS=Fervidobacterium nodosum (... [more]
EFTU_FERIS1.360e-2864.52Elongation factor Tu OS=Fervidobacterium islandicu... [more]
EFTU_DICNV1.360e-2865.59Elongation factor Tu OS=Dichelobacter nodosus (str... [more]
EFTU2_SHESR1.360e-2865.22Elongation factor Tu 2 OS=Shewanella sp. (strain M... [more]
EFTU2_SHESM1.360e-2865.22Elongation factor Tu 2 OS=Shewanella sp. (strain M... [more]
EFTU2_SHEON1.360e-2865.22Elongation factor Tu 2 OS=Shewanella oneidensis GN... [more]
EFTU2_SHELP1.360e-2865.22Elongation factor Tu 2 OS=Shewanella loihica (stra... [more]
EFTU2_SHEB91.360e-2865.22Elongation factor Tu 2 OS=Shewanella baltica (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top