EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SHEB5 (Elongation factor Tu 2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tuf2 PE=3 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_PASMU (Elongation factor Tu-B OS=Pasteurella multocida GN=tufB PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KM V LI P+A +QG+RFAIREGG+TVGAGV+  II+
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_SHELP (Elongation factor Tu 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_SHEB9 (Elongation factor Tu 1 OS=Shewanella baltica (strain OS195) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_SHEB5 (Elongation factor Tu 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_PASMU (Elongation factor Tu-A OS=Pasteurella multocida GN=tufA PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KM V LI P+A +QG+RFAIREGG+TVGAGV+  II+
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SORC5 (Elongation factor Tu OS=Sorangium cellulosum (strain So ce56) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.776e-28
Identity = 62/90 (68.89%), Postives = 70/90 (77.78%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            VYVLKKEEGGRH+PFF  YRPQFY+RTTDVTG V+       E  KMVMPGD + M +ELI PVA E+ MRFAIREGGKTVGAGV+  I+
Sbjct:  311 VYVLKKEEGGRHTPFFTNYRPQFYIRTTDVTGTVNL-----PEGVKMVMPGDNITMTIELIAPVALEEQMRFAIREGGKTVGAGVVTKIL 395          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NAUPA (Elongation factor Tu OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=tuf PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.776e-28
Identity = 63/93 (67.74%), Postives = 70/93 (75.27%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY L KEEGGRH PFF GYRPQFY+RTTDVTG V        E  +MVMPGD VK+ VELI P+A E+G RFAIREGG+TVGAGV+  IIE
Sbjct:  312 AEVYALTKEEGGRHKPFFNGYRPQFYIRTTDVTGSVIL-----PEGVEMVMPGDNVKLTVELIAPIALEEGTRFAIREGGRTVGAGVVTKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_METCA (Elongation factor Tu OS=Methylococcus capsulatus GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.776e-28
Identity = 60/93 (64.52%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A +YVL KEEGGRH+PFF GYRPQFY RTTDVTG V+       E  +MVMPGD VK+ V+LI P+A ++G+RFA+REGG+TVGAGV+  IIE
Sbjct:  309 AEIYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGAVTL-----PEGVEMVMPGDNVKIEVKLIAPIAMDEGLRFAVREGGRTVGAGVVSKIIE 396          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_DEISP (Elongation factor Tu OS=Deinonema sp. GN=tuf PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.776e-28
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            ASVYVL K+EGGRHS FF GYRPQFY RTTDVTG V     +  E  +MVMPGD +  VVELI P+A E+G+RFAIREGG+TVGAGV+  ++E
Sbjct:  318 ASVYVLSKDEGGRHSAFFGGYRPQFYFRTTDVTGVV-----ELPEGVEMVMPGDNITFVVELIKPIAMEEGLRFAIREGGRTVGAGVVAKVLE 405          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU2_SHEB51.360e-2865.22Elongation factor Tu 2 OS=Shewanella baltica (stra... [more]
EFTU2_PASMU1.360e-2864.52Elongation factor Tu-B OS=Pasteurella multocida GN... [more]
EFTU1_SHELP1.360e-2865.22Elongation factor Tu 1 OS=Shewanella loihica (stra... [more]
EFTU1_SHEB91.360e-2865.22Elongation factor Tu 1 OS=Shewanella baltica (stra... [more]
EFTU1_SHEB51.360e-2865.22Elongation factor Tu 1 OS=Shewanella baltica (stra... [more]
EFTU1_PASMU1.360e-2864.52Elongation factor Tu-A OS=Pasteurella multocida GN... [more]
EFTU_SORC51.776e-2868.89Elongation factor Tu OS=Sorangium cellulosum (stra... [more]
EFTU_NAUPA1.776e-2867.74Elongation factor Tu OS=Nautilia profundicola (str... [more]
EFTU_METCA1.776e-2864.52Elongation factor Tu OS=Methylococcus capsulatus G... [more]
EFTU_DEISP1.776e-2865.59Elongation factor Tu OS=Deinonema sp. GN=tuf PE=3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top