EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_THEEB (Elongation factor Tu OS=Thermosynechococcus elongatus (strain BP-1) GN=tuf PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.553e-32
Identity = 63/91 (69.23%), Postives = 77/91 (84.62%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG ++S  +D    ++MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  319 VYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTITSFTSDDGSAAEMVMPGDRIKMTVELIQPIAIEQGMRFAIREGGRTIGAGVVSKIIE 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_BIGNA (Elongation factor Tu, chloroplastic OS=Bigelowiella natans GN=tufA PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.553e-32
Identity = 62/93 (66.67%), Postives = 80/93 (86.02%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDE-ESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S+ +D+D  E +MV+PGDRV M VEL+ P+A E+GMRFAIREGG+TVGAGV+ +++
Sbjct:  317 AQVYILTKEEGGRHTPFFKGYRPQFYVRTTDVTGKIESLKSDEDNTEMRMVVPGDRVTMSVELVQPIAIEKGMRFAIREGGRTVGAGVVSNVV 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROM3 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.648e-32
Identity = 63/91 (69.23%), Postives = 76/91 (83.52%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD +KM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIQ 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_GUITH (Elongation factor Tu, chloroplastic OS=Guillardia theta GN=tufA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.648e-32
Identity = 62/91 (68.13%), Postives = 76/91 (83.52%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF+GYRPQFY+RTTDVTG ++   +D    ++MVMPGDR+KM  +LI P+A E+GMRFAIREGG+TVGAGV+  IIE
Sbjct:  318 VYVLTKEEGGRHTPFFSGYRPQFYVRTTDVTGTIAQFTSDDGSTAEMVMPGDRIKMTAQLIHPIAIEKGMRFAIREGGRTVGAGVVSKIIE 408          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNSC (Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.459e-32
Identity = 63/91 (69.23%), Postives = 76/91 (83.52%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD ++M  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIQMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNR3 (Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.459e-32
Identity = 64/91 (70.33%), Postives = 76/91 (83.52%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +      +MVMPGD +KM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTDRDGGNVEMVMPGDNIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVTKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNP2 (Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=tuf PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.517e-32
Identity = 62/93 (66.67%), Postives = 75/93 (80.65%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +S+   D    ++MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+GAG +  I++
Sbjct:  317 AEVYVLTKEEGGRHTPFFPNYRPQFYVRTTDVTGTISAFTADDGSSAEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGTVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROWI (Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.705e-32
Identity = 63/93 (67.74%), Postives = 75/93 (80.65%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGR +PFF+GYRPQFY+RTTDVTG++ S   D  E  KMV+PGDR+KM  ELI P+A E+ MRFAIREGGKTVGAGV+  I++
Sbjct:  317 AQVYVLNKEEGGRDTPFFSGYRPQFYVRTTDVTGKIESFCTDAGEPIKMVLPGDRIKMKAELIQPIAIERNMRFAIREGGKTVGAGVVGKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNS9 (Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.314e-31
Identity = 62/91 (68.13%), Postives = 75/91 (82.42%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD ++M  ELI PVA E GMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIQMTGELICPVAMEMGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_RHDSA (Elongation factor Tu, chloroplastic OS=Rhodomonas salina GN=tufA PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.314e-31
Identity = 61/91 (67.03%), Postives = 74/91 (81.32%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG ++    D    ++MVMPGDR+KM  +LI P+A E+GMRFAIREGG+TVGAGV+  I+E
Sbjct:  319 VYVLTKEEGGRHTPFFTGYRPQFYVRTTDVTGTIAQFTADDGSAAEMVMPGDRIKMTAQLIHPIAIEKGMRFAIREGGRTVGAGVVSKILE 409          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_THEEB1.553e-3269.23Elongation factor Tu OS=Thermosynechococcus elonga... [more]
EFTU_BIGNA1.553e-3266.67Elongation factor Tu, chloroplastic OS=Bigelowiell... [more]
EFTU_PROM32.648e-3269.23Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_GUITH2.648e-3268.13Elongation factor Tu, chloroplastic OS=Guillardia ... [more]
EFTU_SYNSC3.459e-3269.23Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_SYNR33.459e-3270.33Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_SYNP24.517e-3266.67Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_PROWI7.705e-3267.74Elongation factor Tu, plastid OS=Prototheca wicker... [more]
EFTU_SYNS91.314e-3168.13Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_RHDSA1.314e-3167.03Elongation factor Tu, chloroplastic OS=Rhodomonas ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top