EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PSEAK (Elongation factor Tu, chloroplastic OS=Pseudendoclonium akinetum GN=tufA PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.314e-31
Identity = 62/93 (66.67%), Postives = 75/93 (80.65%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   E+ M   GDR+KMVVELI P+A E GMRFAIREGG+TVGAGV+ +I++
Sbjct:  317 AQVYILTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFTADDGSEALMATSGDRLKMVVELIQPIAVENGMRFAIREGGRTVGAGVVSTILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_EMIHU (Elongation factor Tu, chloroplastic OS=Emiliania huxleyi GN=tufA PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.314e-31
Identity = 62/93 (66.67%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL K+EGGRH+PFF GYRPQFY+RT DVTG +     D    ++MVMPGDR+KM  ELI P+A EQGMRFAIREGG+TVGAGV+  I+E
Sbjct:  315 AEVYVLGKDEGGRHTPFFTGYRPQFYVRTIDVTGTIVQFTGDDGSAAEMVMPGDRIKMTAELINPIAIEQGMRFAIREGGRTVGAGVVSKILE 407          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CYAPA (Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 1.314e-31
Identity = 59/93 (63.44%), Postives = 76/93 (81.72%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL K+EGGRH+PFF+GYRPQFY+RTTDVTG + +   D    ++MVMPGDR+KM V L+ P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  317 SEVYVLTKDEGGRHTPFFSGYRPQFYVRTTDVTGSIDAFTADDGSNAEMVMPGDRIKMTVSLVHPIAIEQGMRFAIREGGRTIGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CHAVU (Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.314e-31
Identity = 60/93 (64.52%), Postives = 78/93 (83.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+L+KEEGGRHSPFFAGYRPQF++RT DVTG + +   D  ++++MVMPGDRVKM+V LI P+A E+ MRFAIREGG+T+GAGV+  I++
Sbjct:  318 AQVYILRKEEGGRHSPFFAGYRPQFFVRTADVTGVIEAFEYDNGDKTRMVMPGDRVKMIVNLICPIAIEKKMRFAIREGGRTIGAGVVLQILD 410          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SPIPL (Elongation factor Tu OS=Spirulina platensis GN=tuf PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.717e-31
Identity = 61/92 (66.30%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VY+LKKEEGGRH+PFF GYRPQFY+RTTDVTG +     D     +MV+PGDR+ M V+LI P+A EQGMRFAIREGG+TVGAGV+  I+
Sbjct:  318 AEVYILKKEEGGRHTPFFKGYRPQFYVRTTDVTGTIDEFTADDGSTPEMVIPGDRINMTVQLICPIAIEQGMRFAIREGGRTVGAGVVAKIL 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PORYE (Elongation factor Tu, chloroplastic OS=Porphyra yezoensis GN=tufA PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.717e-31
Identity = 61/93 (65.59%), Postives = 75/93 (80.65%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG ++    D   +++MVMPGDR+KM  ELI  +A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  317 AEVYILTKEEGGRHTPFFPGYRPQFYVRTTDVTGTINQFTADDGTDAEMVMPGDRIKMTAELINAIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PORPU (Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.717e-31
Identity = 61/93 (65.59%), Postives = 75/93 (80.65%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG ++    D   +++MVMPGDR+KM  ELI  +A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  317 AEVYILTKEEGGRHTPFFPGYRPQFYVRTTDVTGTINQFTADDGTDAEMVMPGDRIKMTAELINAIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CYAP8 (Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.717e-31
Identity = 61/91 (67.03%), Postives = 75/91 (82.42%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF  Y+PQFY+RTTDVTG +    +D+ E  +MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  319 VYVLTKEEGGRHTPFFKNYKPQFYVRTTDVTGSIVDYTSDEGETVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNS3 (Elongation factor Tu OS=Synechococcus sp. (strain CC9311) GN=tuf PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.242e-31
Identity = 62/91 (68.13%), Postives = 75/91 (82.42%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD ++M  ELI PVA E GMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIQMTGELICPVAMELGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ODOSI (Elongation factor Tu, chloroplastic OS=Odontella sinensis GN=tufA PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.928e-31
Identity = 61/93 (65.59%), Postives = 74/93 (79.57%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL K+EGGRH+PFF GYRPQFY+RTTDVTG ++    D     +MVMPGDR+KM  ELI PVA E+GMRFAIREGG+T+GAGV+  II+
Sbjct:  317 SEVYVLTKDEGGRHTPFFTGYRPQFYVRTTDVTGAITQFTADDGSIVEMVMPGDRIKMTAELIYPVAIEEGMRFAIREGGRTIGAGVVSKIIQ 409          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_PSEAK1.314e-3166.67Elongation factor Tu, chloroplastic OS=Pseudendocl... [more]
EFTU_EMIHU1.314e-3166.67Elongation factor Tu, chloroplastic OS=Emiliania h... [more]
EFTU_CYAPA1.314e-3163.44Elongation factor Tu, cyanelle OS=Cyanophora parad... [more]
EFTU_CHAVU1.314e-3164.52Elongation factor Tu, chloroplastic OS=Chara vulga... [more]
EFTU_SPIPL1.717e-3166.30Elongation factor Tu OS=Spirulina platensis GN=tuf... [more]
EFTU_PORYE1.717e-3165.59Elongation factor Tu, chloroplastic OS=Porphyra ye... [more]
EFTU_PORPU1.717e-3165.59Elongation factor Tu, chloroplastic OS=Porphyra pu... [more]
EFTU_CYAP81.717e-3167.03Elongation factor Tu OS=Cyanothece sp. (strain PCC... [more]
EFTU_SYNS32.242e-3168.13Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_ODOSI2.928e-3165.59Elongation factor Tu, chloroplastic OS=Odontella s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top