EY756239
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756239 vs. ExPASy Swiss-Prot
Match: MED7_YARLI (Mediator of RNA polymerase II transcription subunit 7 OS=Yarrowia lipolytica GN=MED7 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11 Identity = 29/87 (33.33%), Postives = 56/87 (64.37%), Query Frame = 3 Query: 51 ELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRRLK 311 EL+ L + L L +EL+ ++ P Q+ + E + ++ N+HH+LN RPHQAR +L+ +++ QI +KQ VE+I++ ++ + ++ Sbjct: 106 ELKKLTKSLLLAFVELTGIMGVSPEQFPAKFEHVRVLLINIHHILNEYRPHQARESLVTLMQQQINDKKQHVENIRQSCDKVRDTIR 192
BLAST of EY756239 vs. ExPASy Swiss-Prot
Match: MED7_ASPNC (Mediator of RNA polymerase II transcription subunit 7 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med7 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11 Identity = 35/96 (36.46%), Postives = 55/96 (57.29%), Query Frame = 3 Query: 6 RPSALLPGPNIDFKKELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREE 293 R S P ++ L +++ L L+ LE VL P Q+ +VED+ +F N HHLLN RPHQAR +LI ++E Q+ R K+ ++ + + + E Sbjct: 115 RQSPSEPSRPLNHAYYLLKISKSLLLNFLEFVGVLSVSPEQFESKVEDLRNLFINAHHLLNLYRPHQARESLIMMMEEQLSRTKEEIQQMDKLKAE 210
BLAST of EY756239 vs. ExPASy Swiss-Prot
Match: MED7_KLULA (Mediator of RNA polymerase II transcription subunit 7 OS=Kluyveromyces lactis GN=MED7 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.435e-11 Identity = 34/97 (35.05%), Postives = 62/97 (63.92%), Query Frame = 3 Query: 27 GPNIDFK-KELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRRLKE 314 G N + K +E + L + L L+ LEL +L S+Y +++++I +I N+HHLLN RPHQ+R +LI + E Q++ +++ +E I + +E + +L + Sbjct: 116 GTNYENKIQESKKLMKSLLLNFLELIGILGVDSSRYEKKLDEIRVIAINIHHLLNEYRPHQSRESLIMLFEEQLEHKRKEMEHINKVCDEVESKLAQ 212 The following BLAST results are available for this feature:
BLAST of EY756239 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756239 ID=EY756239; Name=EY756239; organism=Citrus sinensis; type=EST; length=608bpback to top |