EY756237
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756237 vs. ExPASy Swiss-Prot
Match: 14331_ECHGR (14-3-3 protein homolog 1 OS=Echinococcus granulosus PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 9.407e-13 Identity = 33/50 (66.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 10 RACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDA 159 +AC+LAK AFD AI+E+D++ +E+YKDSTLIMQLLRDNLTLW S+ D+ Sbjct: 195 KACSLAKAAFDAAITEVDSIKDETYKDSTLIMQLLRDNLTLWNSECETDS 244
BLAST of EY756237 vs. ExPASy Swiss-Prot
Match: 1433B_SHEEP (14-3-3 protein beta/alpha (Fragments) OS=Ovis aries GN=YWHAB PE=1 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 7.964e-12 Identity = 34/41 (82.93%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 43 EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGD 165 EAI+ELDTL EESYKDSTLIMQLLRDNLTLWTS+ D GD Sbjct: 151 EAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD 191 The following BLAST results are available for this feature:
BLAST of EY756237 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 142
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756237 ID=EY756237; Name=EY756237; organism=Citrus sinensis; type=EST; length=490bpback to top |