EY756095
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA_SORMA (Tubulin alpha chain OS=Sordaria macrospora GN=TUBA PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.852e-12 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 YSKRAFVHWYVGEGMEEGEFSEARE LAALE DY Sbjct: 399 YSKRAFVHWYVGEGMEEGEFSEAREVLAALEADY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA_ENCCU (Tubulin alpha chain OS=Encephalitozoon cuniculi GN=TUB1 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.852e-12 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 +SKRAFVHWYVGEGMEEGEFSEAREDLA LE DY Sbjct: 395 FSKRAFVHWYVGEGMEEGEFSEAREDLAMLEDDY 428
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA_AVESA (Tubulin alpha chain OS=Avena sativa GN=TUBA PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.852e-12 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLA LEK Y Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAXLEKXY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA3E_HUMAN (Tubulin alpha-3E chain OS=Homo sapiens GN=TUBA3E PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 1.972e-11 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKD 111 Y+K AFVHWYVGEGMEEGEFSEAREDLAALEKD Sbjct: 399 YAKWAFVHWYVGEGMEEGEFSEAREDLAALEKD 431
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA2_HOMAM (Tubulin alpha-2 chain OS=Homarus americanus PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.972e-11 Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEE +FSEAREDLA LEKDY Sbjct: 399 YAKRAFVHWYVGEGMEERQFSEAREDLATLEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA_DICDI (Tubulin alpha chain OS=Dictyostelium discoideum GN=tubA PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.393e-11 Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 + KRAFVHWYVGEGMEEGEF+EAR+DL ALEKDY Sbjct: 408 FVKRAFVHWYVGEGMEEGEFAEARDDLLALEKDY 441 The following BLAST results are available for this feature:
BLAST of EY756095 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 136
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756095 ID=EY756095; Name=EY756095; organism=Citrus sinensis; type=EST; length=362bpback to top |