EY756095
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBAA_SCHCO (Tubulin alpha-1A chain OS=Schizophyllum commune GN=TUB-1A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 YSKRAFVHWYVGEGMEEGEFSEAR+DLAALEKDY Sbjct: 398 YSKRAFVHWYVGEGMEEGEFSEARQDLAALEKDY 431
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA8_RAT (Tubulin alpha-8 chain OS=Rattus norvegicus GN=Tuba8 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA8_MOUSE (Tubulin alpha-8 chain OS=Mus musculus GN=Tuba8 PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA8_HUMAN (Tubulin alpha-8 chain OS=Homo sapiens GN=TUBA8 PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA8_CHICK (Tubulin alpha-8 chain (Fragment) OS=Gallus gallus PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 274 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 307
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA8_BOVIN (Tubulin alpha-8 chain OS=Bos taurus GN=TUBA8 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA6_MAIZE (Tubulin alpha-6 chain OS=Zea mays GN=TUBA6 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA6_ARATH (Tubulin alpha-6 chain OS=Arabidopsis thaliana GN=TUBA6 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA5_MAIZE (Tubulin alpha-5 chain OS=Zea mays GN=TUBA5 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432
BLAST of EY756095 vs. ExPASy Swiss-Prot
Match: TBA4_GOSHI (Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.594e-13 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 13 YSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 114 Y+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY Sbjct: 399 YTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 432 The following BLAST results are available for this feature:
BLAST of EY756095 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 136
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756095 ID=EY756095; Name=EY756095; organism=Citrus sinensis; type=EST; length=362bpback to top |