EY756094

Overview
NameEY756094
Unique NameEY756094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length789
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7063 contig Csv1_Contig7063:16..806. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX1_NICPL (Probable glutathione S-transferase MSR-1 OS=Nicotiana plumbaginifolia GN=MSR-1 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 7.056e-36
Identity = 78/157 (49.68%), Postives = 101/157 (64.33%), Query Frame = 3
Query:   84 SPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGW 554
            S F MR RIAL +K ++YE  EENL  KS LLL+ NPVHKKIP+LIHN KP+CESL I+EY+DE W    P +LPSDPY R+ ARFWA Y+D K++   + + S  G E +E A ++ IE    LE         K +FGG  +GF+D+A   +  W
Sbjct:   14 SSFGMRLRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILIHNGKPICESLNILEYIDEVWHEKCP-LLPSDPYQRSQARFWANYIDNKIYSTGRRVWSGKG-EDQEEAKKEFIEIFKTLEGEL----GNKTYFGGDNLGFVDVALVPFTSW 164          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX3_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.204e-35
Identity = 79/168 (47.02%), Postives = 110/168 (65.48%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGWVRVTE 569
            +LG W SPF  R   ALK+K V+YE++EE+  +KS LLL+SNPVHKK+PVLIHN KP+ ES++I+EY+DE +   GPSILP DPYDRA+ARFW+ ++ +K+   + +       E +E   E++ E L +L++      K K FF G + GF DIA      W+ V E
Sbjct:    6 LLGFWYSPFTHRVEWALKLKGVKYEYIEEDRDNKSSLLLQSNPVHKKVPVLIHNGKPIVESMVILEYIDETF--EGPSILPKDPYDRALARFWSKFLGDKVAAVVNTFFRK--GEEQEKGKEEVYEMLKVLDNEL----KDKKFFVGDKFGFADIAANLVGFWLGVFE 165          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTXA_ARATH (Glutathione S-transferase 103-1A OS=Arabidopsis thaliana GN=103-1A PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.775e-32
Identity = 74/159 (46.54%), Postives = 102/159 (64.15%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLF-PALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFG 539
            +LG W SPF  R  +ALK+K + YE++EE L +KS LLL  NP+HKK+PVL+HN K + ES +I+EY+DE W  +   ILP DPY+R+ ARF+A  VDE++      S+  AD  + +E   EQ+ E ++ LE   V    GK +FGG  +GFLD   G
Sbjct:    9 LLGIWASPFSRRVEMALKLKGIPYEYVEEILENKSPLLLALNPIHKKVPVLVHNGKTILESHVILEYIDETWPQN--PILPQDPYERSKARFFAKLVDEQIMNVGFISMARAD-EKGREVLAEQVRELIMYLEKELV----GKDYFGGKTVGFLDFVAG 160          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTU1_ORYSJ (Probable glutathione S-transferase GSTU1 OS=Oryza sativa subsp. japonica GN=GSTU1 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.431e-28
Identity = 74/173 (42.77%), Postives = 105/173 (60.69%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILP-------SDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFF---GGSQIGFLDIAFGCYLGW 554
            +L  W SPF  R RIA+  K +E+E+ EE+LG+KS+LLL+SNPVH+KIPVL+H  +PV ESL+I++Y+D+A+  + P +LP          Y RA ARFWA YVD KL+     +    G E + AA  ++ E L  LE         + FF   GG ++GF+D+A   +  W
Sbjct:    9 LLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESLVILQYLDDAFPGT-PHLLPPANSGDADAAYARATARFWADYVDRKLYDCGSRLWRLKG-EPQAAAGREMAEILRTLEAEL----GDREFFGGGGGGRLGFVDVALVPFTAW 175          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTU1_ORYSI (Probable glutathione S-transferase GSTU1 OS=Oryza sativa subsp. indica GN=GSTU1 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.175e-28
Identity = 72/172 (41.86%), Postives = 105/172 (61.05%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSD------PYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFF---GGSQIGFLDIAFGCYLGW 554
            +L  W SPF  R RIA+  K +E+E+ EE+LG+KS+LLL+SNPVH+KIPVL+H  +PV ESL+I++Y+D+A+  +   + P++       Y RA ARFWA YVD KL+     +    G E + AA  ++ E L  LE         + FF   GG ++GF+D+A   +  W
Sbjct:    9 LLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESLVILQYLDDAFPGTPHLLSPANSGDADAAYARATARFWADYVDRKLYDCGSRLWRLKG-EPQAAAGREMAEILRTLEAEL----GDREFFGGGGGGRLGFVDVALVPFTAW 175          
The following BLAST results are available for this feature:
BLAST of EY756094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
GSTX1_NICPL7.056e-3649.68Probable glutathione S-transferase MSR-1 OS=Nicoti... [more]
GSTX3_TOBAC1.204e-3547.02Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTXA_ARATH2.775e-3246.54Glutathione S-transferase 103-1A OS=Arabidopsis th... [more]
GSTU1_ORYSJ2.431e-2842.77Probable glutathione S-transferase GSTU1 OS=Oryza ... [more]
GSTU1_ORYSI3.175e-2841.86Probable glutathione S-transferase GSTU1 OS=Oryza ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-E06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756094 ID=EY756094|Name=EY756094|organism=Citrus sinensis|type=EST|length=789bp
CCACGCGTCCGAGAGCAGAGCTTAGAGAAAAAAAAAAAAAGAAAATGGCA
AAAAGCGACGTGAAGGTTTTGGGTGCGTGGCCAAGCCCATTTGTGATGAG
GGCAAGAATCGCACTTAAGATCAAGTCTGTGGAGTATGAGTTTCTGGAGG
AGAATTTGGGATCCAAAAGCGAGCTTCTGCTTAAATCAAACCCTGTTCAC
AAGAAAATCCCAGTTCTGATTCACAATGATAAGCCTGTTTGCGAATCTCT
CATCATTGTCGAGTACGTGGATGAGGCTTGGTCCTCTTCAGGTCCCTCTA
TTCTTCCTTCTGATCCTTATGACCGTGCCGTTGCTCGTTTCTGGGCCGCT
TATGTTGATGAGAAGTTGTTCCCTGCCTTGAAAAGCATTGGTAGTGCAGA
TGGAGCGGAAGCTAAGGAAGCTGCGATTGAGCAATTGATTGAAGGCTTGG
TTTTGCTGGAGGATGCTTTTGTTAAGTGTAGCAAAGGGAAGCCTTTCTTT
GGTGGAAGCCAAATTGGGTTTCTTGACATTGCATTTGGTTGCTACTTGGG
ATGGGTGAGAGTGACAGAGAAATGATTGAGGTGAAGCTCCTTGATGAAGT
CAAAACTCCTGGACTGTTTCAATGGGCTGAGAGATTCTGTGCTGATGCCG
CCTGTCAAGATGTTATGCCTGAAACTGATAAGCTTGCAGAGTTTGCTAAG
GTTCTTGGCAAACTCAGAGCTTCTGGCAAATGAATTAAGAAACTTTAATC
TGTGCTTGGAGGGGCACAAAAAAAGGAAAAAAAAAAAAA
back to top