EY728532
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY728532 vs. ExPASy Swiss-Prot
Match: AROB_DESRM (3-dehydroquinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=aroB PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.420e-11 Identity = 31/45 (68.89%), Postives = 36/45 (80.00%), Query Frame = -1 Query: 1 QPNVVLIDTATLNTLPPRELSAGLAEVIKYGLICDEPFLTWLEEH 135 QP +V+ID ATL TLP REL AGLAEVIKYG+I D F TWLE++ Sbjct: 160 QPQMVMIDVATLQTLPERELKAGLAEVIKYGVIWDGSFFTWLEKN 204
BLAST of EY728532 vs. ExPASy Swiss-Prot
Match: AROB_PSYCK (3-dehydroquinate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=aroB PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.690e-11 Identity = 32/45 (71.11%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 1 QPNVVLIDTATLNTLPPRELSAGLAEVIKYGLICDEPFLTWLEEH 135 QP +VL D +TL TLP RELSAGLAEVIKY LI D FLTWLE + Sbjct: 168 QPQMVLADMSTLKTLPARELSAGLAEVIKYALIMDAEFLTWLEHN 212
BLAST of EY728532 vs. ExPASy Swiss-Prot
Match: AROB_PSYA2 (3-dehydroquinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aroB PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.690e-11 Identity = 32/45 (71.11%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 1 QPNVVLIDTATLNTLPPRELSAGLAEVIKYGLICDEPFLTWLEEH 135 QP +VL D +TL TLP RELSAGLAEVIKY LI D FLTWLE + Sbjct: 173 QPQMVLADMSTLKTLPARELSAGLAEVIKYALIMDADFLTWLEHN 217 The following BLAST results are available for this feature:
BLAST of EY728532 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 43
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY728532 ID=EY728532; Name=EY728532; organism=Citrus sinensis; type=EST; length=135bpback to top |