EY753810
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY753810 vs. ExPASy Swiss-Prot
Match: RER1_CHICK (Protein RER1 OS=Gallus gallus GN=RER1 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.892e-13 Identity = 32/46 (69.57%), Postives = 38/46 (82.61%), Query Frame = 2 Query: 2 AFVLTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPF 139 A TFF F+VPVFWPIL+ Y+I+LF +TM+RQI HMIKYRYIPF Sbjct: 132 AMACTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPF 177
BLAST of EY753810 vs. ExPASy Swiss-Prot
Match: RER1_CAEEL (Protein RER1 homolog OS=Caenorhabditis elegans GN=rer-1 PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 8.415e-13 Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 2 Query: 2 AFVLTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFNI 145 A TFF FDVPVFWPIL+ Y+ +L LT++RQI HMIKYRYIPF + Sbjct: 127 AITCTFFEFFDVPVFWPILVMYFFILTFLTLKRQIMHMIKYRYIPFTV 174
BLAST of EY753810 vs. ExPASy Swiss-Prot
Match: RER1_SCHPO (Protein rer1 OS=Schizosaccharomyces pombe GN=rer1 PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.875e-12 Identity = 30/48 (62.50%), Postives = 38/48 (79.17%), Query Frame = 2 Query: 2 AFVLTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFNI 145 A V +FF +FDVPVFWPIL+ Y++VL RRQI HM+KYRY+PF+I Sbjct: 129 ALVASFFRIFDVPVFWPILVVYYLVLSFFCFRRQIQHMLKYRYVPFDI 176
BLAST of EY753810 vs. ExPASy Swiss-Prot
Match: RER1_DICDI (Protein RER1 homolog OS=Dictyostelium discoideum GN=rer1 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.707e-11 Identity = 27/44 (61.36%), Postives = 36/44 (81.82%), Query Frame = 2 Query: 14 TFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFNI 145 TF D+PVFWPILL Y+I++F +TM++QI HMIKY+YIPF + Sbjct: 135 TFIPFLDLPVFWPILLLYFIIIFSVTMKKQIKHMIKYKYIPFTV 178 The following BLAST results are available for this feature:
BLAST of EY753810 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY753810 ID=EY753810; Name=EY753810; organism=Citrus sinensis; type=EST; length=471bpback to top |