FK826724

Overview
NameFK826724
Unique NameFK826724
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length162
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6119 contig Csv1_Contig6119:617..778. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RAB1B_HUMAN (Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 32/50 (64.00%), Postives = 37/50 (74.00%), Query Frame = -2
Query:    9 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARP 158
            TAK FAD +GIPF+ETSAK++TNVEQAFM MAA IK RM    +    RP
Sbjct:  135 TAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERP 184          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RAB1B_BOVIN (Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 32/50 (64.00%), Postives = 37/50 (74.00%), Query Frame = -2
Query:    9 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARP 158
            TAK FAD +GIPF+ETSAK++TNVEQAFM MAA IK RM    +    RP
Sbjct:  135 TAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERP 184          
The following BLAST results are available for this feature:
BLAST of FK826724 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
RAB1B_HUMAN9.851e-1164.00Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1... [more]
RAB1B_BOVIN9.851e-1164.00Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone492 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 492, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826724 ID=FK826724|Name=FK826724|organism=Citrus sinensis|type=EST|length=162bp
ACAGTTGGAGGCCTTGCATTGTTCATGGATGGTTGACTTGCCATTCTACC
CTTGATTGAAGCAGCCATGGCCATGAATGCCTGTTCCACGTTGGTAGAAT
CTTTTGCACTAGTTTCCATGAAAGGTATTCCAATTTCATCTGCAAATGCC
TTGGCTGTTTCG
back to top