FK826629

Overview
NameFK826629
Unique NameFK826629
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length463
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIA1B_MOUSE (E3 ubiquitin-protein ligase SIAH1B OS=Mus musculus GN=Siah1b PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 6.381e-18
Identity = 40/82 (48.78%), Postives = 50/82 (60.98%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  LG IR LA+EKVA S+  PCKY   GC    P+  K +HE +C FRPY+CP  G+ C   G +  ++ HL   HK
Sbjct:   72 CPTCRGPLGSIRNLAVEKVANSVLFPCKYSASGCEITLPHTKKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHK 153          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIA1_CAEEL (E3 ubiquitin-protein ligase sia-1 OS=Caenorhabditis elegans GN=sia-1 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 2.964e-15
Identity = 35/82 (42.68%), Postives = 48/82 (58.54%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR     +R L LEK+A ++  PCK+   GCP  F +  K +HE +C FRPY CP  G+ C   G +  ++ HL+  HK
Sbjct:  121 CPTCRGPTPSVRNLGLEKIANTVRFPCKFSTSGCPLNFHHADKTEHEELCEFRPYCCPCPGASCKWQGGLSDVMEHLKKIHK 202          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA_DROWI (E3 ubiquitin-protein ligase sina OS=Drosophila willistoni GN=sina PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.624e-15
Identity = 36/82 (43.90%), Postives = 47/82 (57.32%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L +IR LA+EKVA +++ PCK+   GC     Y  K +HE  C  RPY CP  G+ C   G +  ++ HL   HK
Sbjct:  121 CPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHK 202          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA_DROME (E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster GN=sina PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 8.624e-15
Identity = 36/82 (43.90%), Postives = 47/82 (57.32%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L +IR LA+EKVA +++ PCK+   GC     Y  K +HE  C  RPY CP  G+ C   G +  ++ HL   HK
Sbjct:  104 CPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHK 185          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA_DROER (E3 ubiquitin-protein ligase sina OS=Drosophila erecta GN=sina PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.624e-15
Identity = 36/82 (43.90%), Postives = 47/82 (57.32%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L +IR LA+EKVA +++ PCK+   GC     Y  K +HE  C  RPY CP  G+ C   G +  ++ HL   HK
Sbjct:  104 CPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHK 185          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINAL_DROME (Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster GN=sinah PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 8.624e-15
Identity = 37/82 (45.12%), Postives = 44/82 (53.66%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CP CR  + +IR LA+EKVA  L  PCK+ H GC     Y  K KHE  C  RPY CPY    CS  G +  +  HL   H+
Sbjct:  137 CPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHE 218          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA_DROVI (E3 ubiquitin-protein ligase sina OS=Drosophila virilis GN=sina PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.509e-14
Identity = 35/82 (42.68%), Postives = 47/82 (57.32%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L +IR LA+E+VA +++ PCK+   GC     Y  K +HE  C  RPY CP  G+ C   G +  ++ HL   HK
Sbjct:  104 CPTCRGPLANIRNLAMEEVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHK 185          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH2_DANRE (E3 ubiquitin-protein ligase Siah2 OS=Danio rerio GN=siah2l PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 4.280e-14
Identity = 38/83 (45.78%), Postives = 47/83 (56.63%), Query Frame = 2
Query:   11 CPTCRQELG-DIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L   IR LA+EKVA +L  PCKY   GC     +  K +HE +C FRPY CP  G+ C   G +  ++ HL   HK
Sbjct:  120 CPTCRGPLTPSIRNLAMEKVASTLPFPCKYSSAGCLLSLHHSEKPEHEEVCEFRPYTCPCPGASCKWQGSLEEVMPHLMHAHK 202          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH2_XENLA (E3 ubiquitin-protein ligase siah2 OS=Xenopus laevis GN=siah2 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.301e-14
Identity = 36/83 (43.37%), Postives = 48/83 (57.83%), Query Frame = 2
Query:   11 CPTCRQELG-DIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L   IR LA+EKVA ++  PCKY   GC     +  K +HE +C +RPY+CP  G+ C   G +  ++ HL   HK
Sbjct:  100 CPTCRASLTPSIRNLAMEKVASAVLFPCKYASTGCSLSLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLENVMQHLTHSHK 182          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH2_RAT (E3 ubiquitin-protein ligase SIAH2 OS=Rattus norvegicus GN=Siah2 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 1.245e-13
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 2
Query:   11 CPTCRQELG-DIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L   IR LA+EKVA ++  PCKY   GC     +  K +HE +C +RPY+CP  G+ C   G +  +++HL   HK
Sbjct:  112 CPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHK 194          
The following BLAST results are available for this feature:
BLAST of FK826629 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
SIA1B_MOUSE6.381e-1848.78E3 ubiquitin-protein ligase SIAH1B OS=Mus musculus... [more]
SIA1_CAEEL2.964e-1542.68E3 ubiquitin-protein ligase sia-1 OS=Caenorhabditi... [more]
SINA_DROWI8.624e-1543.90E3 ubiquitin-protein ligase sina OS=Drosophila wil... [more]
SINA_DROME8.624e-1543.90E3 ubiquitin-protein ligase sina OS=Drosophila mel... [more]
SINA_DROER8.624e-1543.90E3 ubiquitin-protein ligase sina OS=Drosophila ere... [more]
SINAL_DROME8.624e-1545.12Probable E3 ubiquitin-protein ligase sinah OS=Dros... [more]
SINA_DROVI2.509e-1442.68E3 ubiquitin-protein ligase sina OS=Drosophila vir... [more]
SIAH2_DANRE4.280e-1445.78E3 ubiquitin-protein ligase Siah2 OS=Danio rerio G... [more]
SIAH2_XENLA7.301e-1443.37E3 ubiquitin-protein ligase siah2 OS=Xenopus laevi... [more]
SIAH2_RAT1.245e-1343.37E3 ubiquitin-protein ligase SIAH2 OS=Rattus norveg... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone385 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 385, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826629 ID=FK826629|Name=FK826629|organism=Citrus sinensis|type=EST|length=463bp
ACACAACCGGTGCCCCACTTGTAGACAGGAGCTCGGAGATATTAGGTGTT
TAGCATTGGAGAAGGTGGCTGAATCACTTGAACTGCCATGCAAGTATTAC
CACCTGGGTTGCCCAGAGCTATTTCCATATTACAGCAAACTTAAACATGA
GGTTATGTGCACCTTCAGACCGTATAACTGCCCATATGCTGGGTCAGATT
GCTCTGTCGTTGGGGACATCCCATACTTGGTTGCCCATTTGAGGGACGAT
CACAAAGTAGATATGCACACAGGATGCACATTCAATCATCGCTATGTGAA
GTCCAATCCCCGTGAAGTAGAGAATGCTACTTGGATGCTTACAGTAAGTG
TATTTGATTAAAGATTCGTTAATTTGCTCTATACATTTGACGTAAGTGTG
ATGGTTCCTGGAAAATATAGTGTTTTAACATTAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAG
back to top