FK826629

Overview
NameFK826629
Unique NameFK826629
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length463
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH2_MOUSE (E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus GN=Siah2 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 1.245e-13
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 2
Query:   11 CPTCRQELG-DIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L   IR LA+EKVA ++  PCKY   GC     +  K +HE +C +RPY+CP  G+ C   G +  +++HL   HK
Sbjct:  112 CPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHK 194          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH2_HUMAN (E3 ubiquitin-protein ligase SIAH2 OS=Homo sapiens GN=SIAH2 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.245e-13
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 2
Query:   11 CPTCRQELG-DIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L   IR LA+EKVA ++  PCKY   GC     +  K +HE +C +RPY+CP  G+ C   G +  +++HL   HK
Sbjct:  111 CPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHK 193          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINL6_ARATH (Putative E3 ubiquitin-protein ligase SINA-like 6 OS=Arabidopsis thaliana GN=At5g37870 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.798e-12
Identity = 36/94 (38.30%), Postives = 49/94 (52.13%), Query Frame = 2
Query:    5 NRCPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHKVDMHTGCTFN 286
            N+CP C   +G IRC A+E+V ES+ +PC+Y  LGC +   Y  +  HE +C F P +CP  G  C+  G    L  H    H     T  +FN
Sbjct:   75 NKCPACALPVGHIRCRAMERVLESVLVPCRYADLGCTKTIYYGRESTHEKICNFSPCSCPVQG--CNYTGSYKDLYEHYDLTHSTG-STAYSFN 165          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIL10_ARATH (E3 ubiquitin-protein ligase SINA-like 10 OS=Arabidopsis thaliana GN=At5g37930 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.798e-12
Identity = 47/142 (33.10%), Postives = 69/142 (48.59%), Query Frame = 2
Query:    5 NRCPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHKVDMHTGCTFNHRYV-------KSNPREVENATWMLTVSVFD*RFVNLLYTFDVSVMVP 409
            NRCP+C   +G +RC A+EKV E+  + C     GC E   Y ++  HE +C F P +CP    DC   G    L  H+R +HK D+     +N R         K+   + EN   ++ V VF  R ++ +Y   VS + P
Sbjct:  143 NRCPSCTLPIGYVRCRAMEKVIEASRVSCLNAKYGCKESTSYGNRFSHEQVCVFTPCSCPIL--DCHYTGYYKDLNNHVRAEHKDDL-ISFVWNTRLTISLDLNKKTTILQEENDGHVIVVQVF--RALHAVYV-SVSCIAP 278          
The following BLAST results are available for this feature:
BLAST of FK826629 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
SIAH2_MOUSE1.245e-1343.37E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus ... [more]
SIAH2_HUMAN1.245e-1343.37E3 ubiquitin-protein ligase SIAH2 OS=Homo sapiens ... [more]
SINL6_ARATH1.798e-1238.30Putative E3 ubiquitin-protein ligase SINA-like 6 O... [more]
SIL10_ARATH1.798e-1233.10E3 ubiquitin-protein ligase SINA-like 10 OS=Arabid... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone385 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 385, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826629 ID=FK826629|Name=FK826629|organism=Citrus sinensis|type=EST|length=463bp
ACACAACCGGTGCCCCACTTGTAGACAGGAGCTCGGAGATATTAGGTGTT
TAGCATTGGAGAAGGTGGCTGAATCACTTGAACTGCCATGCAAGTATTAC
CACCTGGGTTGCCCAGAGCTATTTCCATATTACAGCAAACTTAAACATGA
GGTTATGTGCACCTTCAGACCGTATAACTGCCCATATGCTGGGTCAGATT
GCTCTGTCGTTGGGGACATCCCATACTTGGTTGCCCATTTGAGGGACGAT
CACAAAGTAGATATGCACACAGGATGCACATTCAATCATCGCTATGTGAA
GTCCAATCCCCGTGAAGTAGAGAATGCTACTTGGATGCTTACAGTAAGTG
TATTTGATTAAAGATTCGTTAATTTGCTCTATACATTTGACGTAAGTGTG
ATGGTTCCTGGAAAATATAGTGTTTTAACATTAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAG
back to top