FE659326
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK33_ARATH (Probable WRKY transcription factor 33 OS=Arabidopsis thaliana GN=WRKY33 PE=1 SV=2) HSP 1 Score: 117.087 bits (292), Expect = 2.886e-26 Identity = 53/56 (94.64%), Postives = 54/56 (96.43%), Query Frame = -3 Query: 57 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSG 224 QKVVKGNPNPRSYYKCT GCPVRKHVERASHD+RAVITTYEGKHNHDVPAARGSG Sbjct: 372 QKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDMRAVITTYEGKHNHDVPAARGSG 427
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRKY2_ARATH (Probable WRKY transcription factor 2 OS=Arabidopsis thaliana GN=WRKY2 PE=2 SV=1) HSP 1 Score: 111.694 bits (278), Expect = 1.212e-24 Identity = 50/55 (90.91%), Postives = 52/55 (94.55%), Query Frame = -3 Query: 60 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGS 224 QKVVKGNPNPRSYYKCT PGC VRKHVERASHDL++VITTYEGKHNHDVPAAR S Sbjct: 497 QKVVKGNPNPRSYYKCTAPGCTVRKHVERASHDLKSVITTYEGKHNHDVPAARNS 551
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK20_ARATH (Probable WRKY transcription factor 20 OS=Arabidopsis thaliana GN=WRKY20 PE=2 SV=1) HSP 1 Score: 103.605 bits (257), Expect = 3.302e-22 Identity = 45/60 (75.00%), Postives = 52/60 (86.67%), Query Frame = -3 Query: 45 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSGSRAL 224 QKVV+GNPNPRSYYKCT GCPVRKHVERASHD +AVITTYEGKH+HDVP ++ S + + Sbjct: 391 QKVVRGNPNPRSYYKCTAHGCPVRKHVERASHDPKAVITTYEGKHDHDVPTSKSSSNHEI 450
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK58_ARATH (Probable WRKY transcription factor 58 OS=Arabidopsis thaliana GN=WRKY58 PE=2 SV=1) HSP 1 Score: 102.064 bits (253), Expect = 9.607e-22 Identity = 47/59 (79.66%), Postives = 50/59 (84.75%), Query Frame = -3 Query: 48 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSGSRA 224 QKVVKGNP+PRSYYKCT P C VRKHVERAS D +AVITTYEGKHNHDVPAAR + A Sbjct: 316 QKVVKGNPHPRSYYKCTTPNCTVRKHVERASTDAKAVITTYEGKHNHDVPAARNGTAAA 374
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRKY4_ARATH (Probable WRKY transcription factor 4 OS=Arabidopsis thaliana GN=WRKY4 PE=1 SV=2) HSP 1 Score: 99.7525 bits (247), Expect = 4.768e-21 Identity = 45/59 (76.27%), Postives = 50/59 (84.75%), Query Frame = -3 Query: 48 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSGSRA 224 QKVVKGNP PRSYYKCT PGC VRKHVERA+ D +AV+TTYEGKHNHD+PAA+ S A Sbjct: 419 QKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPAAKSSSHAA 477
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRKY3_ARATH (Probable WRKY transcription factor 3 OS=Arabidopsis thaliana GN=WRKY3 PE=2 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 4.768e-21 Identity = 46/62 (74.19%), Postives = 51/62 (82.26%), Query Frame = -3 Query: 39 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSGSRALPD 224 QKVVKGNP PRSYYKCT P C VRKHVERA+ D +AV+TTYEGKHNHDVPAAR S + P+ Sbjct: 425 QKVVKGNPYPRSYYKCTTPDCGVRKHVERAATDPKAVVTTYEGKHNHDVPAARTSSHQLRPN 486 HSP 2 Score: 69.707 bits (169), Expect = 5.284e-12 Identity = 32/57 (56.14%), Postives = 41/57 (71.93%), Query Frame = -3 Query: 54 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSGS 224 QK VKG+ PRSYYKCTHP CPV+K VER S D + Y+G+HNH++P RG+ + Sbjct: 260 QKQVKGSDFPRSYYKCTHPACPVKKKVER-SLDGQVTEIIYKGQHNHELPQKRGNNN 315
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK34_ARATH (Probable WRKY transcription factor 34 OS=Arabidopsis thaliana GN=WRKY34 PE=2 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 1.696e-18 Identity = 42/55 (76.36%), Postives = 45/55 (81.82%), Query Frame = -3 Query: 60 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGS 224 QKVVKGNPNPRSYYKCT GC V KHVERAS D ++V+TTY GKH H VPAAR S Sbjct: 382 QKVVKGNPNPRSYYKCTANGCTVTKHVERASDDFKSVLTTYIGKHTHVVPAARNS 436
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRKY1_ARATH (WRKY transcription factor 1 OS=Arabidopsis thaliana GN=WRKY1 PE=1 SV=1) HSP 1 Score: 90.8929 bits (224), Expect = 2.215e-18 Identity = 37/53 (69.81%), Postives = 46/53 (86.79%), Query Frame = -3 Query: 66 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAAR 224 QK VKG+P PRSYY+C+ PGCPV+KHVER+SHD + +ITTYEGKH+HD+P R Sbjct: 317 QKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMPPGR 369
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK26_ARATH (Probable WRKY transcription factor 26 OS=Arabidopsis thaliana GN=WRKY26 PE=2 SV=2) HSP 1 Score: 89.7373 bits (221), Expect = 4.934e-18 Identity = 40/53 (75.47%), Postives = 43/53 (81.13%), Query Frame = -3 Query: 66 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAAR 224 QKVVKGNPNPRSYYKCT GC VRKHVERA D ++VITTYEGKH H +P R Sbjct: 244 QKVVKGNPNPRSYYKCTFTGCFVRKHVERAFQDPKSVITTYEGKHKHQIPTPR 296
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK25_ARATH (Probable WRKY transcription factor 25 OS=Arabidopsis thaliana GN=WRKY25 PE=1 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 2.449e-17 Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = -3 Query: 69 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAA 224 QKVVKGN NPRSYYKCT GC V+K VER++ D RAV+TTYEG+HNHD+P A Sbjct: 338 QKVVKGNTNPRSYYKCTFQGCGVKKQVERSAADERAVLTTYEGRHNHDIPTA 389 The following BLAST results are available for this feature:
BLAST of FE659326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659326 ID=FE659326; Name=FE659326; organism=Citrus sinensis; type=EST; length=226bpback to top |