FE659326
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK28_ARATH (Probable WRKY transcription factor 28 OS=Arabidopsis thaliana GN=WRKY28 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.816e-12 Identity = 34/60 (56.67%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 48 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPA-ARGSGSRA 224 QK VK +P PRSYY+CT C V+K VER+ D VITTYEG+HNH +P RGS + A Sbjct: 182 QKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPTVVITTYEGQHNHPIPTNLRGSSAAA 241
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK71_ARATH (Probable WRKY transcription factor 71 OS=Arabidopsis thaliana GN=WRKY71 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.097e-12 Identity = 31/51 (60.78%), Postives = 37/51 (72.55%), Query Frame = -3 Query: 72 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPA 224 QK VK +P PRSYY+CT C V+K VER+ D VITTYEGKHNH +P+ Sbjct: 146 QKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPSIVITTYEGKHNHPIPS 196
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK61_ARATH (Probable WRKY transcription factor 61 OS=Arabidopsis thaliana GN=WRKY61 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.045e-12 Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = -3 Query: 75 QKVVKGNPNPRSYYKCT-HPGCPVRKHVERASHDLRAVITTYEGKHNHDVP 224 QK+ KGNP PR+YY+CT CPVRK V+R S D+ +I+TYEG HNH +P Sbjct: 201 QKIAKGNPCPRAYYRCTIAASCPVRKQVQRCSEDMSILISTYEGTHNHPLP 251
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK47_ARATH (Probable WRKY transcription factor 47 OS=Arabidopsis thaliana GN=WRKY47 PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 6.900e-12 Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = -3 Query: 75 QKVVKGNPNPRSYYKCTHP-GCPVRKHVERASHDLRAVITTYEGKHNHDVP 224 QK+ KGNP PR+YY+CT GCPVRK V+R + D + TTYEG HNH +P Sbjct: 249 QKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDTTILTTTYEGNHNHPLP 299
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK48_ARATH (Probable WRKY transcription factor 48 OS=Arabidopsis thaliana GN=WRKY48 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.537e-11 Identity = 30/50 (60.00%), Postives = 36/50 (72.00%), Query Frame = -3 Query: 75 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVP 224 QK VK +P PRSYY+CT GC V+K VER+S D V+TTYEG+H H P Sbjct: 231 QKAVKNSPYPRSYYRCTTVGCGVKKRVERSSDDPSIVMTTYEGQHTHPFP 280
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRKY8_ARATH (Probable WRKY transcription factor 8 OS=Arabidopsis thaliana GN=WRKY8 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.008e-11 Identity = 30/53 (56.60%), Postives = 36/53 (67.92%), Query Frame = -3 Query: 66 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAAR 224 QK VK +P PRSYY+CT C V+K VER+ D VITTYE +HNH +P R Sbjct: 193 QKAVKNSPYPRSYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHNHPIPTNR 245
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRKY7_ARATH (Probable WRKY transcription factor 7 OS=Arabidopsis thaliana GN=WRKY7 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.008e-11 Identity = 30/48 (62.50%), Postives = 35/48 (72.92%), Query Frame = -3 Query: 84 QKVVKGNPNPRSYYKCTHP-GCPVRKHVERASHDLRAVITTYEGKHNH 224 QK +KG+P+PR YYKC+ GCP RKHVERA D +I TYEG HNH Sbjct: 291 QKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDAMMLIVTYEGDHNH 338
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK50_ARATH (Probable WRKY transcription factor 50 OS=Arabidopsis thaliana GN=WRKY50 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.008e-11 Identity = 29/47 (61.70%), Postives = 36/47 (76.60%), Query Frame = -3 Query: 84 QKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNH 224 +K+VK +P+PR+YYKC+ GCPV+K VER D VITTYEG HNH Sbjct: 123 KKMVKNSPHPRNYYKCSVDGCPVKKRVERDRDDPSFVITTYEGSHNH 169
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK11_ARATH (Probable WRKY transcription factor 11 OS=Arabidopsis thaliana GN=WRKY11 PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 2.008e-11 Identity = 31/52 (59.62%), Postives = 37/52 (71.15%), Query Frame = -3 Query: 72 QKVVKGNPNPRSYYKC-THPGCPVRKHVERASHDLRAVITTYEGKHNHDVPA 224 QK +KG+P+PR YYKC T GCP RKHVERA D +I TYEG+H H+ A Sbjct: 256 QKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGEHRHNQSA 307
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK17_ARATH (Probable WRKY transcription factor 17 OS=Arabidopsis thaliana GN=WRKY17 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 2.622e-11 Identity = 30/48 (62.50%), Postives = 35/48 (72.92%), Query Frame = -3 Query: 84 QKVVKGNPNPRSYYKC-THPGCPVRKHVERASHDLRAVITTYEGKHNH 224 QK +KG+P+PR YYKC T GCP RKHVERA D +I TYEG+H H Sbjct: 253 QKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDSTMLIVTYEGEHRH 300 The following BLAST results are available for this feature:
BLAST of FE659326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659326 ID=FE659326; Name=FE659326; organism=Citrus sinensis; type=EST; length=226bpback to top |