FE659326
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRKY1_MAIZE (Protein WRKY1 OS=Zea mays PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.629e-11 Identity = 29/49 (59.18%), Postives = 35/49 (71.43%), Query Frame = -3 Query: 81 QKVVKGNPNPRSYYKCTHP-GCPVRKHVERASHDLRAVITTYEGKHNHD 224 QK +KG+P+PR YYKC+ GCP RKHVER D +I TYEG HNH+ Sbjct: 342 QKPIKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHN 390
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK74_ARATH (Probable WRKY transcription factor 74 OS=Arabidopsis thaliana GN=WRKY74 PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.629e-11 Identity = 28/48 (58.33%), Postives = 35/48 (72.92%), Query Frame = -3 Query: 84 QKVVKGNPNPRSYYKCTHP-GCPVRKHVERASHDLRAVITTYEGKHNH 224 QK +KG+P+PR YYKC+ GCP RKHVER + +I TYEG+HNH Sbjct: 272 QKPIKGSPHPRGYYKCSSVRGCPARKHVERCVEETSMLIVTYEGEHNH 319
BLAST of FE659326 vs. ExPASy Swiss-Prot
Match: WRK39_ARATH (Probable WRKY transcription factor 39 OS=Arabidopsis thaliana GN=WRKY39 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.964e-11 Identity = 28/48 (58.33%), Postives = 35/48 (72.92%), Query Frame = -3 Query: 84 QKVVKGNPNPRSYYKCTHP-GCPVRKHVERASHDLRAVITTYEGKHNH 224 QK +KG+P+PR YYKC+ GCP RKHVER + +I TYEG+HNH Sbjct: 272 QKPIKGSPHPRGYYKCSSVRGCPARKHVERCIDETSMLIVTYEGEHNH 319 The following BLAST results are available for this feature:
BLAST of FE659326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659326 ID=FE659326; Name=FE659326; organism=Citrus sinensis; type=EST; length=226bpback to top |