FE659184
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_CHICK (Cytochrome c OS=Gallus gallus GN=CYC PE=1 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 5.669e-11 Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KC+QCHTVEKG HK GPNL+GLFGR++G G Sbjct: 2 GDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC2_XENLA (Cytochrome c, testis-specific OS=Xenopus laevis GN=cyct PE=3 SV=3) HSP 1 Score: 66.2402 bits (160), Expect = 5.669e-11 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+K+F KC+QCHTVEKG HK GPNL+GLFGR++G G Sbjct: 2 GDVEKGKKVFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC1_XENTR (Cytochrome c, somatic OS=Xenopus tropicalis GN=cycs PE=3 SV=3) HSP 1 Score: 65.855 bits (159), Expect = 7.404e-11 Identity = 29/45 (64.44%), Postives = 34/45 (75.56%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KCAQCHTVEK HK GPNL GLFGR++G PG Sbjct: 2 GDVEKGKKIFVQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC1B_XENLA (Cytochrome c, somatic B OS=Xenopus laevis GN=cycs-B PE=3 SV=3) HSP 1 Score: 65.855 bits (159), Expect = 7.404e-11 Identity = 30/45 (66.67%), Postives = 34/45 (75.56%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+A G+KIF KCAQCHTVEK HK GPNL GLFGR++G PG Sbjct: 2 GDAGKGKKIFIQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_STELP (Cytochrome c OS=Stellaria longipes PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 27/45 (60.00%), Postives = 36/45 (80.00%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+AK G +FKT+CAQCHT+ +G G+K GPNL+GLFGR +G+ G Sbjct: 6 GDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRHTGSVEG 50
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_SQUSU (Cytochrome c OS=Squalus sucklii GN=cyc PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 27/45 (60.00%), Postives = 34/45 (75.56%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+K+F KCAQCHTVE G HK GPNL+GLFGR++G G Sbjct: 2 GDVEKGKKVFVQKCAQCHTVENGGKHKTGPNLSGLFGRKTGQAQG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_ISSOR (Cytochrome c OS=Issatchenkia orientalis GN=CYC1 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 27/45 (60.00%), Postives = 33/45 (73.33%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+AK G +FKT+CAQCHT+E G HK GPNL+G+F R SG G Sbjct: 7 GSAKKGATLFKTRCAQCHTIEAGGPHKVGPNLHGIFSRHSGQAEG 51
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_APTPA (Cytochrome c OS=Aptenodytes patagonicus GN=CYC PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KC+QCHTVEKG HK GPNL+G+FGR++G G Sbjct: 2 GDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGIFGRKTGQAEG 46 The following BLAST results are available for this feature:
BLAST of FE659184 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 98
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659184 ID=FE659184; Name=FE659184; organism=Citrus sinensis; type=EST; length=178bpback to top |