EY749268
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY749268 vs. ExPASy Swiss-Prot
Match: NACA_SCLS1 (Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 6.043e-11 Identity = 23/45 (51.11%), Postives = 39/45 (86.67%), Query Frame = 2 Query: 281 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPMTDTYVIF 415 ++ KLG+ +PG++RVT+++ KNILFVI+ P+V+KSP ++TY++F Sbjct: 61 SIAKLGLTRVPGITRVTLRRPKNILFVINNPEVYKSPTSNTYIVF 105 HSP 2 Score: 28.8758 bits (63), Expect = 6.043e-11 Identity = 13/17 (76.47%), Postives = 14/17 (82.35%), Query Frame = 3 Query: 414 FGEAKIEDLSSQLQTQA 464 FGEAKIEDL+SQ Q A Sbjct: 105 FGEAKIEDLNSQAQASA 121
BLAST of EY749268 vs. ExPASy Swiss-Prot
Match: NACA_AJECN (Nascent polypeptide-associated complex subunit alpha OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=EGD2 PE=3 SV=2) HSP 1 Score: 59.3066 bits (142), Expect = 6.052e-11 Identity = 24/45 (53.33%), Postives = 40/45 (88.89%), Query Frame = 2 Query: 281 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPMTDTYVIF 415 A+ KLG+K +PG++RVT+++ K ILFVI++PDV++SP ++T++IF Sbjct: 57 AIGKLGLKHVPGITRVTLRRPKGILFVINQPDVYRSPSSNTWIIF 101 HSP 2 Score: 29.6462 bits (65), Expect = 6.052e-11 Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 3 Query: 414 FGEAKIEDLSSQLQTQAGRAI 476 FGEAKIEDL+SQ Q A + + Sbjct: 101 FGEAKIEDLNSQAQASAAQQL 121 The following BLAST results are available for this feature:
BLAST of EY749268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 32
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY749268 ID=EY749268; Name=EY749268; organism=Citrus sinensis; type=EST; length=959bpback to top |