EY692129
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY692129 vs. ExPASy Swiss-Prot
Match: POT7_ARATH (Potassium transporter 7 OS=Arabidopsis thaliana GN=POT7 PE=1 SV=2) HSP 1 Score: 72.7886 bits (177), Expect = 2.845e-12 Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 2 Query: 233 PSDPGMDPAVRE-------ELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPHISLIEVGMIYYV 478 P D D +V E EL + +AKE+G+ Y++GH ++AR+ S F+K+ +I+ Y+FLRKNCR L++P L++VGM Y V Sbjct: 770 PFDTSSDSSVSEAEQSLERELSFIHKAKESGVVYLLGHGDIRARKDSWFIKKLVINYFYTFLRKNCRRGIANLSVPQSHLMQVGMTYMV 858
BLAST of EY692129 vs. ExPASy Swiss-Prot
Match: POT11_ARATH (Potassium transporter 11 OS=Arabidopsis thaliana GN=POT11 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.412e-11 Identity = 33/71 (46.48%), Postives = 49/71 (69.01%), Query Frame = 2 Query: 266 EELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPHISLIEVGMIYYV 478 +EL + ++AG+ +IMG++ V+ARR + F K+ ID +Y+FLRK CR SV N+P SL+ VG I+YV Sbjct: 722 DELEFINGCRDAGVVHIMGNTVVRARREARFYKKIAIDYVYAFLRKICREHSVIYNVPQESLLNVGQIFYV 792
BLAST of EY692129 vs. ExPASy Swiss-Prot
Match: POT9_ARATH (Potassium transporter 9 OS=Arabidopsis thaliana GN=POT9 PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 3.146e-11 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2 Query: 266 EELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPHISLIEVGMIYYV 478 +EL L KE+G+ +IMG++ VKAR S K+ ID +Y+FL K CR SV L++PH +L+ VG ++YV Sbjct: 737 DELEFLKTCKESGVVHIMGNTVVKARTGSWLPKKIAIDYVYAFLAKICRANSVILHVPHETLLNVGQVFYV 807
BLAST of EY692129 vs. ExPASy Swiss-Prot
Match: POT10_ARATH (Putative potassium transporter 10 OS=Arabidopsis thaliana GN=POT10 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.146e-11 Identity = 31/62 (50.00%), Postives = 44/62 (70.97%), Query Frame = 2 Query: 293 KEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPHISLIEVGMIYYV 478 ++AG+ +IMG++ V+ARR + F KR ID +Y+FLRK CR S N+P SL+ VG I+YV Sbjct: 726 RDAGVVHIMGNTVVRARREARFYKRIAIDYVYAFLRKICRENSAIFNVPQESLLNVGQIFYV 787
BLAST of EY692129 vs. ExPASy Swiss-Prot
Match: HAK14_ORYSJ (Probable potassium transporter 14 OS=Oryza sativa subsp. japonica GN=HAK14 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.146e-11 Identity = 31/71 (43.66%), Postives = 50/71 (70.42%), Query Frame = 2 Query: 266 EELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPHISLIEVGMIYYV 478 +EL + +AKE+G+ Y++GH ++AR+ S FVK+ +I+ Y+FLR+NCR AL+IP +++V M Y V Sbjct: 789 DELSFIHKAKESGVVYLLGHGDIRARKESFFVKKLVINYFYAFLRRNCRRGIAALSIPPSRMMQVAMQYMV 859 The following BLAST results are available for this feature:
BLAST of EY692129 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 25
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY692129 ID=EY692129; Name=EY692129; organism=Citrus sinensis; type=EST; length=867bpback to top |