EY691939
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY691939 vs. ExPASy Swiss-Prot
Match: IPYR_BACP3 (Inorganic pyrophosphatase OS=Bacillus PS3 GN=ppa PE=1 SV=2) HSP 1 Score: 44.669 bits (104), Expect = 4.579e-11 Identity = 21/39 (53.85%), Postives = 26/39 (66.67%), Query Frame = 3 Query: 345 KIFNCVIEIGKGSKVKYELDKKSGLIMVDRVLYSSVVYP 461 KI IEI GS+ KYE DK+ G+ +DRVLYS + YP Sbjct: 6 KIVEAFIEIPTGSQNKYEFDKERGIFKLDRVLYSPMFYP 44 HSP 2 Score: 44.2838 bits (103), Expect = 4.579e-11 Identity = 21/51 (41.18%), Postives = 28/51 (54.90%), Query Frame = 1 Query: 460 PINYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLSG*RPSEFCL*IDQGEE 612 P YG++ TL D DPLD+L+I P PGC + R + +D GEE Sbjct: 44 PAEYGYLQNTLALDGDPLDILVITTNPPFPGCVIDT-RVIGYLNMVDSGEE 93
BLAST of EY691939 vs. ExPASy Swiss-Prot
Match: IPYR_PSEAO (Inorganic pyrophosphatase OS=Pseudanabaena sp. (strain PCC 6903) GN=ppa PE=1 SV=1) HSP 1 Score: 49.2914 bits (116), Expect = 9.959e-11 Identity = 29/55 (52.73%), Postives = 32/55 (58.18%), Query Frame = 3 Query: 318 DLEIGPGAPK--IFNCVIEIGKGSKVKYELDKKSGLIMVDRVLYSSVVYPHKLWF 476 DL P PK I N +IEI GSK KYE DK +DRVLYSSV YP+ F Sbjct: 2 DLSRIPPQPKAGILNVLIEIPAGSKNKYEFDKDLNAFALDRVLYSSVQYPYDYGF 56 HSP 2 Score: 38.5058 bits (88), Expect = 9.959e-11 Identity = 17/33 (51.52%), Postives = 22/33 (66.67%), Query Frame = 1 Query: 460 PINYGFIPRT--LCEDNDPLDVLIIMQEPVLPG 552 P +YGF+P T L +D DPLD ++IM P PG Sbjct: 51 PYDYGFVPITNNLADDGDPLDGMVIMVPPTFPG 83 The following BLAST results are available for this feature:
BLAST of EY691939 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY691939 ID=EY691939; Name=EY691939; organism=Citrus sinensis; type=EST; length=912bpback to top |