EY663124
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_NEIMF (Glycine dehydrogenase [decarboxylating] OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=gcvP PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.677e-11 Identity = 33/47 (70.21%), Postives = 40/47 (85.11%), Query Frame = 2 Query: 5 ASERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQ 145 A +R P +I+GVS D+SGKPALR+A+ TREQHIR +KATSNICTAQ Sbjct: 286 AFKRSAPGRIIGVSKDASGKPALRMALSTREQHIRREKATSNICTAQ 332
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_MYCPA (Glycine dehydrogenase [decarboxylating] OS=Mycobacterium paratuberculosis GN=gcvP PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.677e-11 Identity = 33/50 (66.00%), Postives = 41/50 (82.00%), Query Frame = 2 Query: 2 HASE-RMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQV 148 HA+ R +P ++VGVS+D+ G PA R+A+ TREQHIR DKATSNICTAQV Sbjct: 290 HANHARQLPGRLVGVSLDADGSPAYRLALQTREQHIRRDKATSNICTAQV 339
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_MYCA1 (Glycine dehydrogenase [decarboxylating] OS=Mycobacterium avium (strain 104) GN=gcvP PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.677e-11 Identity = 33/50 (66.00%), Postives = 41/50 (82.00%), Query Frame = 2 Query: 2 HASE-RMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQV 148 HA+ R +P ++VGVS+D+ G PA R+A+ TREQHIR DKATSNICTAQV Sbjct: 290 HANHARQLPGRLVGVSLDADGSPAYRLALQTREQHIRRDKATSNICTAQV 339
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_XYLFT (Glycine dehydrogenase [decarboxylating] OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gcvP PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.497e-11 Identity = 37/71 (52.11%), Postives = 48/71 (67.61%), Query Frame = 2 Query: 11 ERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQV------TYYCYS*SVSGLL---WRT 196 +R IP +++GVS+D++G PA R+A+ TREQHIR +KATSNICTAQV + Y GLL WRT Sbjct: 308 KRSIPGRLIGVSVDAAGHPAYRLALQTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPQGLLRIAWRT 378
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_XYLFA (Glycine dehydrogenase [decarboxylating] OS=Xylella fastidiosa GN=gcvP PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.497e-11 Identity = 37/71 (52.11%), Postives = 48/71 (67.61%), Query Frame = 2 Query: 11 ERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQV------TYYCYS*SVSGLL---WRT 196 +R IP +++GVS+D++G PA R+A+ TREQHIR +KATSNICTAQV + Y GLL WRT Sbjct: 308 KRSIPGRLIGVSVDAAGHPAYRLALQTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPQGLLRIAWRT 378
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_RHOPA (Glycine dehydrogenase [decarboxylating] OS=Rhodopseudomonas palustris GN=gcvP PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.497e-11 Identity = 32/46 (69.57%), Postives = 40/46 (86.96%), Query Frame = 2 Query: 11 ERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQV 148 +R +P +IVG+SIDS G+PA R+A+ TREQHIR +KATSNICTAQV Sbjct: 314 KRSLPGRIVGLSIDSHGQPAYRLALQTREQHIRREKATSNICTAQV 359
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_NITHX (Glycine dehydrogenase [decarboxylating] OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gcvP PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.497e-11 Identity = 31/46 (67.39%), Postives = 40/46 (86.96%), Query Frame = 2 Query: 11 ERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQV 148 +R++P +IVG+S+DS G PA R+A+ TREQHIR +KATSNICTAQV Sbjct: 294 KRLLPGRIVGLSVDSRGAPAYRLALQTREQHIRREKATSNICTAQV 339
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_SYNS9 (Glycine dehydrogenase [decarboxylating] OS=Synechococcus sp. (strain CC9902) GN=gcvP PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.567e-11 Identity = 33/48 (68.75%), Postives = 39/48 (81.25%), Query Frame = 2 Query: 5 ASERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQV 148 A +R IP ++VG S D+ G PALR+A+ TREQHIR DKATSNICTAQV Sbjct: 285 AYKRQIPGRLVGESKDAEGNPALRLALQTREQHIRRDKATSNICTAQV 332
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_NEIMA (Glycine dehydrogenase [decarboxylating] OS=Neisseria meningitidis serogroup A GN=gcvP PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.567e-11 Identity = 32/45 (71.11%), Postives = 39/45 (86.67%), Query Frame = 2 Query: 11 ERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQ 145 +R P +I+GVS D+SGKPALR+A+ TREQHIR +KATSNICTAQ Sbjct: 288 KRSAPGRIIGVSKDASGKPALRMALSTREQHIRREKATSNICTAQ 332
BLAST of EY663124 vs. ExPASy Swiss-Prot
Match: GCSP_NEIM0 (Glycine dehydrogenase [decarboxylating] OS=Neisseria meningitidis serogroup C (strain 053442) GN=gcvP PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.567e-11 Identity = 32/45 (71.11%), Postives = 39/45 (86.67%), Query Frame = 2 Query: 11 ERMIPSKIVGVSIDSSGKPALRVAMLTREQHIRMDKATSNICTAQ 145 +R P +I+GVS D+SGKPALR+A+ TREQHIR +KATSNICTAQ Sbjct: 288 KRSAPGRIIGVSKDASGKPALRMALSTREQHIRREKATSNICTAQ 332 The following BLAST results are available for this feature:
BLAST of EY663124 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 71
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY663124 ID=EY663124; Name=EY663124; organism=Citrus sinensis; type=EST; length=928bpback to top |