EY744217
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_BRADI (50S ribosomal protein L16, chloroplastic OS=Brachypodium distachyon GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 7.303e-12 Identity = 37/72 (51.39%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M GK+ RGN ICFGRYALQ L P QIE G +A+ R + RG K WVRIFP+K Sbjct: 3 SPKRTKFRKQHRGRMKGKSCRGNRICFGRYALQALE-PTWITARQIEAGRRAITRYAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_WHEAT (50S ribosomal protein L16, chloroplastic OS=Triticum aestivum GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 37/72 (51.39%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M GK+ RGN ICFGRYALQ L P QIE G +A+ R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGKSCRGNRICFGRYALQALE-PAWITARQIEAGRRAITRYAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_POPTR (50S ribosomal protein L16, chloroplastic OS=Populus trichocarpa GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 38/72 (52.78%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G +SRGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISSRGNRICFGRYALQALE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_POPAL (50S ribosomal protein L16, chloroplastic OS=Populus alba GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 38/72 (52.78%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G +SRGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISSRGNRICFGRYALQALE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_MANES (50S ribosomal protein L16, chloroplastic OS=Manihot esculenta GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 38/72 (52.78%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G A RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGIAFRGNRICFGRYALQALE-PAWITSRQIEAGRRAMTRNAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_LOLPR (50S ribosomal protein L16, chloroplastic OS=Lolium perenne GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 37/72 (51.39%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M GK+ RGN ICFGRYALQ L P QIE G +A+ R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGKSCRGNRICFGRYALQALE-PAWITARQIEAGRRAITRYAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_LEPVR (50S ribosomal protein L16, chloroplastic OS=Lepidium virginicum GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMSRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_AMBTC (50S ribosomal protein L16, chloroplastic OS=Amborella trichopoda GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 37/72 (51.39%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G +SRGN ICFGRYALQ L P QIE G +AM R + RG K WVR+FP+K Sbjct: 3 SPKRTRFRKQHRGRMKGVSSRGNHICFGRYALQALE-PAWITSRQIEAGRRAMTRYAR-RGGKIWVRVFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_AGRST (50S ribosomal protein L16, chloroplastic OS=Agrostis stolonifera GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.538e-12 Identity = 37/72 (51.39%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M GK+ RGN ICFGRYALQ L P QIE G +A+ R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGKSCRGNRICFGRYALQALE-PAWITARQIEAGRRAITRYAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_HORVU (50S ribosomal protein L16, chloroplastic OS=Hordeum vulgare GN=rpl16 PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.627e-11 Identity = 37/71 (52.11%), Postives = 45/71 (63.38%), Query Frame = 3 Query: 534 PNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 P F +H+G+M GK+ RGN ICFGRYALQ L P QIE G +A+ R + RG K WVRIFP+K Sbjct: 5 PKRTRFRKQHRGRMKGKSFRGNRICFGRYALQALE-PAWITARQIEAGRRAITRYAR-RGGKIWVRIFPDK 73 The following BLAST results are available for this feature:
BLAST of EY744217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 58
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY744217 ID=EY744217; Name=EY744217; organism=Citrus sinensis; type=EST; length=951bpback to top |