EY744217
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_NUPAD (50S ribosomal protein L16, chloroplastic OS=Nuphar advena GN=rpl16 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.624e-11 Identity = 37/72 (51.39%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGVSYRGNHICFGRYALQALE-PAWITSRQIEAGRRAMARYAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_LACSA (50S ribosomal protein L16, chloroplastic OS=Lactuca sativa GN=rpl16 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.624e-11 Identity = 36/72 (50.00%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G + RGN ICFG+YALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISYRGNAICFGKYALQALE-PAWITSRQIEAGRRAMTRNAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_VITVI (50S ribosomal protein L16, chloroplastic OS=Vitis vinifera GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 37/72 (51.39%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_PHAVU (50S ribosomal protein L16, chloroplastic OS=Phaseolus vulgaris GN=rpl16 PE=3 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 37/72 (51.39%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G +SRGN ICFGRYALQ L P QIE G +AM R + RG + WVRIFP+K Sbjct: 3 SPQRTRFRKQHRGRMKGISSRGNRICFGRYALQALE-PAWITSRQIEAGRRAMSRNVR-RGGQIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_MORIN (50S ribosomal protein L16, chloroplastic OS=Morus indica GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 37/72 (51.39%), Postives = 44/72 (61.11%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKHHRGRMKGISYRGNHICFGRYALQALE-PAWITSRQIEAGRRAMTRNAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_HELAN (50S ribosomal protein L16, chloroplastic OS=Helianthus annuus GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 36/71 (50.70%), Postives = 44/71 (61.97%), Query Frame = 3 Query: 534 PNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 P F +H+G+M G + RGN ICFG+YALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 5 PKRTRFRKQHRGRMKGISYRGNTICFGKYALQALE-PAWITSRQIEAGRRAMTRNAR-RGGKIWVRIFPDK 73
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_GUIAB (50S ribosomal protein L16, chloroplastic OS=Guizotia abyssinica GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 36/71 (50.70%), Postives = 44/71 (61.97%), Query Frame = 3 Query: 534 PNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 P F +H+G+M G + RGN ICFG+YALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 5 PKRTRFRKQHRGRMKGISYRGNTICFGKYALQALE-PAWITSRQIEAGRRAMTRNAR-RGGKIWVRIFPDK 73
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_GOSHI (50S ribosomal protein L16, chloroplastic OS=Gossypium hirsutum GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 37/72 (51.39%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRNRFRKQHRGRMKGISYRGNRICFGRYALQALE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_GOSBA (50S ribosomal protein L16, chloroplastic OS=Gossypium barbadense GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 37/72 (51.39%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_BUXMI (50S ribosomal protein L16, chloroplastic OS=Buxus microphylla GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.734e-11 Identity = 37/71 (52.11%), Postives = 44/71 (61.97%), Query Frame = 3 Query: 534 PNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 5 PKRTRFRKQHRGRMKGISYRGNRICFGRYALQALE-PTWITSRQIEAGRRAMTRYAR-RGGKIWVRIFPDK 73 The following BLAST results are available for this feature:
BLAST of EY744217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 58
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY744217 ID=EY744217; Name=EY744217; organism=Citrus sinensis; type=EST; length=951bpback to top |